Detailed information on CNT3078381


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674723Brassica junceaSetaria viridis71.9121.7985.42192forward
CNT30641079Brassica junceaNymphaea colorata82.0229.4883.11219forward
CNT30516889Brassica junceaJuglans regia83.937.0282.14224forward
CNT30378644Brassica junceaArabidopsis thaliana92.8887.6391.13248forward
CNT30617295Brassica junceaSesamum indicum68.1644.3984.62182forward
CNT30728061Brassica junceaCorchorus capsularis85.7724.0583.41229forward
CNT30381383Brassica junceaManihot esculenta76.0311.5584.24203forward
CNT30402401Brassica junceaBeta vulgaris40.079.0185.98107forward
CNT30196749Brassica junceaPisum sativum88.0158.3183.83235forward
CNT30155931Brassica junceaPistacia vera88.3976.1381.78236forward
CNT30586804Brassica junceaMusa acuminata74.9125.9184200forward
CNT30553024Brassica junceaOryza glaberrima82.0215.3481.74219forward
CNT30441907Brassica junceaAegilops tauschii75.6679.2285.64202forward
CNT30313575Brassica junceaCamelina sativa75.2886.2783.08201forward
CNT3062349Brassica junceaArabidopsis lyrata80.5224.6883.26215forward
CNT30614348Brassica junceaArabis alpina60.315.2690.68161forward
CNT30608822Brassica junceaGossypium raimondii53.5621.3486.71143forward
CNT30204946Brassica junceaHelianthus annuus44.5731.7389.92119forward
CNT30623465Brassica junceaDaucus carota73.7870.3684.77197forward
CNT30721041Brassica junceaTriticum spelta37.8349.0387.13101forward
CNT30364046Brassica junceaSorghum bicolor85.023986.78227forward
CNT30621035Brassica junceaCajanus cajan73.0328.5183.08195forward
CNT30595970Brassica junceaOryza meridionalis37.4523.282100forward
CNT30569889Brassica junceaVitis vinifera65.9236.9781.82176forward
CNT3054454Brassica junceaAmborella trichopoda52.432583.57140forward
CNT3024644Brassica junceaPopulus trichocarpa82.410.7684.09220forward
CNT30321935Brassica junceaAsparagus officinalis95.1311.9782.68254forward
CNT30116105Brassica junceaOryza nivara74.9127.182200forward

Expression of CNT3078381

Peptides detected in this lncRNA

>peptide 1 (31 aa)
LGVVSLRVLKQISYKASLSRTMHSSAFSTSW*

>peptide 2 (88 aa)
AGGSELKSPEANIIQGLVIKNHALISILNKLVNRQGGVVWLNHSIRDLRRREHREGQHHPIWVLLPDLRYQQCSHPRSSSSSQRMAHLK

Sequence

>CNT3078381
GCTGGGGGTAGTGAGCTTAAGAGTCCTGAAGCAAATATCATACAAGGCCTCGTTATCAAGAACCATGCACTCATCAGCATTCTCAACAAGCTGGTGAACA
GACAAGGTGGCGTTGTATGGCTCAACCACAGTATCAGAGACCTTCGGCGAAGGGAACACAGAGAAGGTCAACATCATCCGATCTGGGTACTCCTCCCTGA
TCTTCGATATCAACAATGTTCCCATCCCAGATCCAGTTCCTCCTCCCAACGAATGGCACACCTGAAA