Detailed information on CNT3077525


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3077525

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MVRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHVHH

>peptide 2 (37 aa)
MAHLELSIPWDGSTKQPPRPTYLKFENRSRTLRPRCL*

Sequence

>CNT3077525
CACCGTCCTCTGGCTTAATCGACCAACACCCTTTGTGGGTTCTAGGTTAGCGCGCAGTTGGGCACCGTAACCCGGCTTCCGGTTCATCCCGCATCGCCAG
TTCTGCTTACCAAAAATGGCCCACTTGGAGCTCTCGATTCCGTGGGATGGCTCAACAAAGCAGCCACCCCGTCCTACCTATTTAAAGTTTGAGAATAGGT
CGAGGACATTGCGTCCCCGATGCCTCTAATCATTGGCTTTACCCGATAGAACTCGTTTCCGAGCTCCAGCTATCCTGAGGGAAACTTCGGAGGGAACCAG
CTACTAGATGGTTCGATTAGTCTTTCGCCCCTATACCCAAGTCAGACGAACGATTTGCACGTCAGTATCGCTGCGGGCCTCCACCAGAGTTTCCTCTGGC
TTCGCCCCGCTCAGGCATGTTCACCATCT