Detailed information on CNT3077104


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3077104

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MVRIRTENQNQASFYPFVPHEISVLVELILGHLRYLLKDVPPQPNSLPDNVLRPD*

>peptide 2 (46 aa)
MDRGSKATLPLTIPRRIFKSSAKDSTRRSVVIIIQGGPNGASAERT*

>peptide 3 (94 aa)
MCRPSQTPYLTMSSARIDPPKRILGLKEGVVTPPPIHGVSKIMLKVGVFHSRWSSHLFYTSQVISQIWTRVNLNRVFFPRLFCQAHSLGCGFAG*

>peptide 4 (38 aa)
MIGRADIEGSKCNVAMNAWLPQASYPCGNFSDTSSFKF*

>peptide 5 (34 aa)
AESQWIVAARPRCHLQYHVAFLSRLQRILPAARW*

Sequence

>CNT3077104
GCTGAATCTCAATGGATCGTGGCAGCAAGGCCACGCTGCCACTTACAATACCACGTCGCATTTTTAAGTCGTCTGCAAAGGATTCTACCCGCCGCTCGGT
GGTAATTATAATTCAAGGCGGTCCGAACGGTGCTTCCGCCGAACGGACTTAGCCAACGACACTTGCCTTTGGGAGCGGAAGCTCCTACTGAAGATCGGCA
ATCGGGCGGCGGGCTCATGCGTTGCTTCTAGCTCCGATTCTGACTTAGAGGCGTTCAGTCATATTCCAGCGCACGGTAGCTTCGCGCTACTGGCTTTTCA
ACCAAGCGTGATGACCAATTGTGCGAATCAACGGTTCCTCTCGTACTAGGTTGAATTACTATTGCGACGCGGGCATCAGTAGGGTAAAACTAACCTGTCT
CACGACGGTCTAAACCCAGCTCACGTTCCTTATTGGTGGGTGAACAATCAAACACTTGGTGAATTCTGCTTCACAATGATAGGAAGAGCCGACATCGAAG
GATCAAAATGCAACGTCGCTATGAACGCTTGGCTGCCACAAGCCAGTTATCCCTGTGGTAACTTTTCTGACACCTCTAGCTTCAAATTCTAAAGGTCTAA
AGGATCGATTGGCCACGCTTTTATGGTTCGTATTCGTACTGAAAATCAAAATCAAGCGAGCTTTTACCCTTTTGTTCCACACGAGATTTCTGTTCTCGTT
GAGCTCATCTTAGGACACCTGCGTTATCTTTTAAAAGATGTGCCGCCCCAGCCAAACTCCCTACCTGACAATGTCCTCCGCCCGGATTGACCCGCCGAAG
CGAATCTTAGGTCTAAAAGAAGGGGTTGTTACCCCGCCTCCGATTCACGGAGTAAGTAAAATAATGTTAAAAGTAGGGGTATTTCACTCGCGCTGGAGCT
CCCACTTATTCTACACCTCTCAAGTCATTTCACAAATTTGGACTAGAGTCAATCTCAACAGGGTCTTCTTTCCCCGCTTATTCTGCCAAGCCCATTCCCT
TGGCTGTGGTTTCGCTGGATAGTAGACAGGGTAAGTGGGAATCTCGTTAATCCATTCATGCGCGTCACTAATTAGATGACAAGGCATTTGGCTACCTTAA
GAGAGTCATAGTTACTCCTGCCGTTTACCTGCGCTTGGTTGAATTTCTTCACTTTGACATTCAGAGCACTGGGCAGAAATCACATTGCGTAGCATCCGCA
GGGACCATCGCAATGCTTTGTTTTAATTAAACAGTCGGATTCCCCTTGTCCGTACCAGTTCTGAGTTGGCTGTTCGACACCCGGGGAAA