Detailed information on CNT3076830


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3076830

Peptides detected in this lncRNA

>peptide 1 (29 aa)
SPKPGMKSVKEYVTKQPAFANPETVFVRK*

>peptide 2 (85 aa)
MDISALASMKNVAKCDTWCELQNPVNHRVFERKRSCPKALDDPESSTRPQVRRDHPLSLSISISGGKETNKDFLSNGERTGNSPS*

Sequence

>CNT3076830
TCACCAAAGCCCGGCATGAAAAGTGTCAAGGAATATGTAACTAAACAGCCTGCTTTTGCCAACCCGGAGACGGTGTTTGTTCGGAAGTAATGCTGCAATG
TAAAGTCTAAAACGACTCTCGACAATGGATATCTCGGCTCTCGCATCGATGAAGAACGTAGCAAAATGCGATACTTGGTGTGAATTGCAGAATCCCGTGA
ACCATCGAGTCTTTGAACGCAAACGTTCTTGTCCAAAAGCTCTTGATGACCCAGAGTCCTCAACGCGACCCCAGGTCAGGCGGGATCACCCGCTGAGTTT
AAGCATATCAATAAGCGGAGGAAAAGAAACTAACAAGGATTTCCTTAGTAACGGCGAGCGAACCGGGAATAGCCCATCTTGAAAGTCGGACGTTTTTGGC
GTTCGAATTGTAGTCTGGAGAAGCGTCCT