Detailed information on CNT3076740


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3076740

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MHRTPRDMRCSSSRWTLPLAEPFPGWAGC*

>peptide 2 (83 aa)
MCKCRSHGTFPLFGLQSSHLNICYYHQDLHRRPLRPGSRPRFCSDRRALLLIEAWLLPRRPGIGRALQRHPFSGLVDSAGELLH

>peptide 3 (95 aa)
GTPEPSPQSQSFSRSYGSILPTSLAYIVPSTRGCSPWRPDAVMSTTGRERHSVLRIFKGRRECTGHHATCGALPAAGPYLWLSRFQGGQAVKQKR*

>peptide 4 (39 aa)
WDPRAQPSEPILFPKLRIHFADFPCLHCSIDQRLFTLET*

>peptide 5 (42 aa)
GPPSPALRANPFPEVTDPFCRLPLPTLFHRPEAVHLGDLMRL*

Sequence

>CNT3076740
TGGGACCCCCGAGCCCAGCCCTCAGAGCCAATCCTTTTCCCGAAGTTACGGATCCATTTTGCCGACTTCCCTTGCCTACATTGTTCCATCGACCAGAGGC
TGTTCACCTTGGAGACCTGATGCGGTTATGAGTACGACCGGGCGTGAGCGCCACTCGGTCCTCCGGATTTTCAAGGGCCGCCGGGAATGCACCGGACACC
ACGCGACATGCGGTGCTCTTCCAGCCGCTGGACCCTACCTCTGGCTGAGCCGTTTCCAGGGTGGGCAGGCTGTTAAACAGAAAAGATAACTCTTTCCGGA
ATTCCCGCCGACGTCTCCGGACTCCCTAACGTTGCCGTCAACCGCCACGTCCCGGTTCTGGAATTTTAACCGGATCCCCTTTCGAAGTTCGCGCATAAGC
GCTATCAGACGGGTTTCCCCCGACTCTTAGGATCGACTAACCCATGTGCAAGTGCCGTTCACATGGAACCTTTCCCCTCTTCGGCCTTCAAAGTTCTCAT
TTGAATATTTGCTACTACCACCAAGATCTGCACCGGCGGCCGCTCCGCCCGGGCTCGCGCCCTAGGTTTTGCAGCGACCGCCGCGCCCTCCTACTCATCG
AGGCCTGGCTCTTGCCCCGACGGCCGGGTATAGGTCGCGCGCTTCAGCGCCATCCATTTTCGGGGCTAGTTGATTCGGCAGGTGAGTTGTTACACAC