Detailed information on CNT307638


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675961Zea maysSetaria viridis15.2827.4498.3159forward
CNT30307361Zea maysTriticum aestivum25.6521.7183.8499forward
CNT30596504Zea maysOryza meridionalis15.0320.4987.9358forward
CNT30557381Zea maysPanicum hallii19.4330.498475forward

Expression of CNT307638

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MILVVGSSSHQTTRRQMVTPSAMASWQTSTRGS*

>peptide 2 (66 aa)
MIYDLGRRIIITSDDAAADGDAVGDGELADLDAGILRKPDVEFPDGGGEPAVEVAERRSSCSWYRT*

Sequence

>CNT307638
AGAACCATGCATTATTAATTGACGACGGCAGCGGACAGCGGCGGGCAGGCAGTTGAAAGATGACAGAGACGACGAGCGAATGATATATGATCTTGGTCGT
CGGATCATCATCACATCAGACGACGCGGCGGCAGATGGTGACGCCGTCGGCGATGGCGAGCTGGCAGACCTCGACGCGGGGATCCTGAGAAAGCCGGACG
TTGAGTTCCCTGATGGCGGCGGAGAACCTGCGGTCGAGGTCGCTGAGCGGCGGAGCAGCTGCTCGTGGTACCGGACGTAGTTAGGCTTGTCGGCGTCGAC
GAAGGCGAAGTCGAAGGCGCCGTGGTTGGCCGGGTCGGCGAGGAGCTCGTCCAGCTGCTCCAGCGCCGGGCCCTCCCGGAAGTCCA