Detailed information on CNT3074265


BLAST search results

BLAST vs Swiss-Prot:
sp|P56331|IF1A_ONOVI, E-value = 9e-47

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671227Brassica junceaSetaria viridis15.484089.22102forward
CNT30521379Brassica junceaSetaria italica22.6123.7384.56149forward
CNT30631858Brassica junceaVigna unguiculata18.5127.2392.62122forward
CNT30708734Brassica junceaGlycine max18.6621.7388.62123forward
CNT30304884Brassica junceaTriticum aestivum22.1531.6788.36146forward
CNT30474933Brassica junceaSaccharum spontaneum29.8931.2282.23197forward
CNT3011199Brassica junceaZea mays29.893381.22197forward
CNT30718760Brassica junceaMalus domestica golden18.6633.4282.11123forward
CNT30368761Brassica junceaSorghum bicolor30.510.8982.59201forward
CNT30619918Brassica junceaCajanus cajan28.688.4891.01189forward
CNT30595805Brassica junceaOryza meridionalis13.6621.0388.8990forward
CNT30573272Brassica junceaVitis vinifera28.6826.0786.77189forward
CNT30102311Brassica junceaOryza rufipogon22.1521.8289.04146forward
CNT30576889Brassica junceaOryza barthii22.1522.2989.04146forward
CNT30725237Brassica junceaLupinus angustifolius24.4330.3888.82161forward

Expression of CNT3074265

Peptides detected in this lncRNA

>peptide 1 (94 aa)
VSLVVLVVSQTDEYDVARGDPDLLVHLAADVAETLGAVDAHALASSVAEHAKDLRVFLSVFFEYELALLVVGFVLSSLPVLSSLSLVLRHGGNC*

>peptide 2 (94 aa)
MMSPAAIQTFLCILPRMWQRRLVPSMHMHSHLPLPSMRRTCAYSCPSSLNMSSRFSSSASFFPLFLFFPPFPLFFGMVVTVKLNRQMIQFKVLS*

Sequence

>CNT3074265
GTCAGCCTTGTCGTCCTGGTAGTCTCTCAGACCGACGAGTATGATGTCGCCCGCGGCGATCCAGACCTTCTTGTGCATCTTGCCGCGGATGTGGCAGAGA
CGCTTGGTGCCGTCGATGCACATGCACTCGCATCTTCCGTTGCCGAGCATGCGAAGGACTTGCGCGTATTCTTGTCCGTCTTCTTTGAATATGAGCTCGC
GCTTCTCGTCGTCGGCTTCGTTCTTTCCTCTCTTCCTGTTCTTTCCTCCCTTTCCCTTGTTCTTCGGCATGGTGGTAACTGTTAAATTAAATAGACAAAT
GATTCAGTTCAAGGTTCTGTCTTAAAAACATGCAAAAAACAAAACTCTTGTCTCTTAGAAAACAAAAGCAGATTCAATTTCGAGCAAGGAGTACAGAAGA
ATCCTAAAACTACAAAATCAAACACTATCACGATAAGCTGGTGGTAGCAAGATCGATCGAAGATACATAGACCTCGCCGATTCAACTAACGATTACGAGA
CCGGGAACCTTAAATCTAGAGGTAAGAGATGAAATGAATCACATAGAAGACGAGAGGATCTACAACTAAGAAGCGATCTGGGACAAAGCTAAGAAGAAAA
CCTCTGGGCTGGGATTAGATTCGGAGATTCCTCTGTTTCTCTTTGGTTATGGATCAAAC