Detailed information on CNT30726197


BLAST search results

BLAST vs Swiss-Prot:
sp|Q58G87|UBQ3_ORYSJ, E-value = 2e-87

BLAST vs NONCODE:
NONTPRT002153, E-value = 6e-87

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30726197

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MKGGLLLDVIVCQGTPILKLLSSEDETLLIWWDTFLILDLSLHIIYGI*

>peptide 2 (31 aa)
MVSELSTSRVMVFPVKVLTKICIPPRRRSTK*

Sequence

>CNT30726197
AAAGTTGAAGGTATAATGACTAATATGTATGAACAATGAAACTTCAGCAATTCACTAATAAAAACAGCAGACATTAGAAGTAACGAAATCCATACCATAA
GACAGCACTTTGTGCATGTTTTGAAAACATGCGAACAGAAAATAAATTGTTCAATAAGAGCCAGAATTAAACAGAACACAACGGACCATTGTTTTTCAAG
GTCCACATTCCACATACACAAACACAATTGAATTCTTAAACATTATGAAATCAAAAGCCCTCCAGGACTTCCACACACCTAACACCAACCGAGGACCAAT
CGAACTTCCACAAGCTTAAATCCCACCACGAAGACGCAACACAAGGTGAAGAGTGGACTCCTTCTGGATGTTATAATCGGCCAAAGTTCGACCGTCCTCA
AGCTGCTTGCCAGCAAAGATAAGCCTCTGCTGATCGGGTGGGATACCCTCCTTGTCTTGGATCTTTGCTTTGACATTGTCAATGGTGTCGGAACTCTCCA
CCTCAAGGGTGATGGTCTTTCCGGTCAAGGTCTTAACAAAGATTTGCATACCACCACGAAGACGGAGCACCAAATGAAGGGTGGACTCCTTTTGGATGTT
ATAGTCTGCCAGGGTACGCCCATCCTCAAGCTGCTTTCCAGCGAAGATGAGACGCTGCTGATCTGGTGGGATACCTTCCTTATCCTGGATCTTAGCCTTC
ACATTATCTATGGTATCTGAACTCT