Detailed information on CNT30726195


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30701275Lupinus angustifoliusQuercus lobata30.9231.8987.5184forward
CNT30379859Lupinus angustifoliusManihot esculenta28.0726.6886.23167forward
CNT30710762Lupinus angustifoliusGlycine max39.8369.7191.14237forward
CNT30164816Lupinus angustifoliusPistacia vera27.0678.9289.44161forward
CNT30592165Lupinus angustifoliusMusa acuminata15.4632.7486.9692forward
CNT30553602Lupinus angustifoliusOryza glaberrima22.0228.2381.68131forward
CNT30172855Lupinus angustifoliusTrifolium pratense40.6729.4491.32242forward
CNT3059740Lupinus angustifoliusArabidopsis lyrata24.0319.8983.92143forward
CNT30610520Lupinus angustifoliusGossypium raimondii45.3832.4184.81270forward
CNT30362130Lupinus angustifoliusSorghum bicolor15.1327.1183.3390forward
CNT3052558Lupinus angustifoliusAmborella trichopoda28.2440.7880.95168forward
CNT3038429Lupinus angustifoliusCucumis melo19.8337.2288.98118forward
CNT30575951Lupinus angustifoliusOryza barthii22.0230.1881.68131forward
CNT30113199Lupinus angustifoliusFicus carica25.0434.1787.25149forward
CNT30333083Lupinus angustifoliusCynara cardunculus34.4555.5681.95205forward

Expression of CNT30726195

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MLMLIKLDSLLQINIRNFIEALPHMVHSIYIKAKRSSYLTIKH*

>peptide 2 (36 aa)
MVSSVELLHCEHIADFAVLVCLGTIKLSTIYHDRTV*

>peptide 3 (30 aa)
MTELFSPFKPPASPLKSPRLAFGGTFPANVF

Sequence

>CNT30726195
AATCAGAAGATTTTTTAAATTTTTTGATAACCAAAACACTTGTTAAAGGACTCTTAAAAAATTGAACACCAACTTTAGATGGTGACCCAAGATAGACAAT
GTAAAACATCTAATGCTTATGCTAATTAAGTTGGACTCGCTATTGCAGATAAATATCAGAAACTTTATAGAAGCACTTCCTCATATGGTTCATTCAATCT
ACATCAAGGCAAAAAGAAGTTCCTACCTAACAATCAAACATTAATGAACTCATCATAACAAGATCTTCACTCTTCTTGAGACTTCATTTTTCTGCATGTG
CATGTTGGAGGGAATAGAGTCCTGAACAAGGGAATGTGCTCCCTAAACAAGCCTGTAGTGGCAATGCAACCGGGGTAAAGGGAAGCAAATGTGATCCCGG
TTTCCTCATGGTATCTTCTGTGGAACTCTTGCATTGTGAGCATATTGCAGACTTTGCTGTCCTTGTATGCCTTGGCACCATCAAACTCTCCACCATCTAT
CATGACCGAACTGTTTAGCCCGTTCAAGCCACCCGCAAGTCCCCTCAAGTCGCCGAGGTTAGCCTTTGGAGGTACATTTCCAGCCAATGTATTTG