Detailed information on CNT30726149


BLAST search results

BLAST vs Swiss-Prot:
sp|Q58G87|UBQ3_ORYSJ, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 2e-178

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30532219Lupinus angustifoliusEucalyptus grandis45.5451.5582.47867forward
CNT30701594Lupinus angustifoliusQuercus lobata45.3884.2182.52864forward
CNT30274489Lupinus angustifoliusChenopodium quinoa47.7974.3584.4910forward
CNT3019912Lupinus angustifoliusCitrullus lanatus4854.783.37914forward
CNT30727227Lupinus angustifoliusCorchorus capsularis35.2458.486.14671forward
CNT30379426Lupinus angustifoliusManihot esculenta46.4376.3483.6884forward
CNT30526024Lupinus angustifoliusPhaseolus vulgaris47.7968.7885.6910forward
CNT3044330Lupinus angustifoliusPrunus dulcis47.7974.4185.16910forward
CNT30156153Lupinus angustifoliusPistacia vera46.1176.2283.14878forward
CNT3094992Lupinus angustifoliusSolanum tuberosum47.8578.2684.08911forward
CNT30568725Lupinus angustifoliusActinidia chinensis46.976.9881.86893forward
CNT30311185Lupinus angustifoliusCamelina sativa46.4866.8482.94885forward
CNT30608664Lupinus angustifoliusGossypium raimondii4882.2781.73914forward
CNT3066849Lupinus angustifoliusLeersia perrieri47.968.2681.8912forward
CNT30653057Lupinus angustifoliusRosa chinensis47.9569.0184.34913forward
CNT30623426Lupinus angustifoliusDaucus carota47.8550.5583.53911forward
CNT30480747Lupinus angustifoliusArabidopsis halleri47.9578.7182.04913forward
CNT30153569Lupinus angustifoliusPrunus persica35.0874.0685.63668forward
CNT30423866Lupinus angustifoliusPapaver somniferum46.5969.3583.2887forward
CNT30704854Lupinus angustifoliusPrunus avium47.8551.0985.73911forward
CNT30642514Lupinus angustifoliusCannabis sativa47.7982.2882.64910forward
CNT3027950Lupinus angustifoliusTheobroma cacao45.6999.5484.6870forward
CNT3026527Lupinus angustifoliusPopulus trichocarpa46.5990.7983.88887forward
CNT30326890Lupinus angustifoliusAsparagus officinalis47.0172.5382.79895forward
CNT30330420Lupinus angustifoliusDioscorea rotundata47.9553.9681.6913forward
CNT30174676Lupinus angustifoliusVigna angularis46.6983.0183.8889forward
CNT30111662Lupinus angustifoliusFicus carica47.8567.3883.21911forward
CNT30334109Lupinus angustifoliusCynara cardunculus46.855.4882.6891forward

Expression of CNT30726149

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MRRCWSGGIPSLSWILAFTLSIVSELSTSKVIVLPVRVLTKICIPPRRRSTK*

>peptide 2 (41 aa)
MTNVPKEHQTKTLIIKSKHQDRRPKQIRLSQFHQLIKNSQP*

>peptide 3 (48 aa)
MKGGLLLDVIVCQGTPILKLLSSEDETLLIWWDTFLILDLSLHIIYGI*

>peptide 4 (31 aa)
MVSELSTSNVIVFPVRVFTKICIPPLKRRTR*

Sequence

>CNT30726149
AAAGTTGAAGGTATAATGACTAATATGTATGAACAATGAAACTTCAGCAATTCACTAATAAAAACAGCAGACATTAGAAGTAACGAAATCCATACCATAA
GACAGCACTTTGTGCATGTTTTGAAAACATGCGAACAGAAAATAAATTGTTCAATAAGAGCCAGAATTAAACAGAACACAACGGACCATTGTTTTTCAAG
GTCCACATTCCACATACACAAACACAATTGAATTCTTAAACATTATGAAATCAAAAGCCCTCCAGGACTTCCACACACCTAACACCAACCGAGGACCAAT
CGAACTTCCACAAGCTTAAATCCCACCACGAAGACGCAACACAAGGTGAAGAGTAGATTCCTTCTGAATGTTGTAGTCAGCAAGGGTCCTTCCATCCTCC
AACTGCTTCCCGGCAAAGATCAACCTCTGCTGGTCAGGTGGGATCCCCTCCTTGTCCTGGATTTTTGCCTTCACATTATCGATGGTGTCCGAACTCTCCA
CCTCCAATGTAATAGTCTTCCCAGTCAGAGTCTTCACAAAGATCTGCATTCCTCCCCTCAAACGAAGGACAAGGTGAAGGGTGGACTCCTTCTGAATATT
GTAATCTGCCAGGGTACGTCCATCTTCAAGTTGCTTTCCAGCAAAAATCAACCTTTGCTGGTCTGGAGGGATACCTTCCTTATCCTGGATCTTAGCCTTC
ACATTGTCAATCGTGTCCGAGCTCTCAACCTCCAAAGTGATTGTCTTCCCGGTAAGGGTCTTCACAAAGATTTGCATACCACCACGGAGACGAAGCACCA
AATGAAGGGTGGACTCCTTTTGGATGTTATAGTCTGCTAGGGTACGCCCATCCTCAAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGAGGGAT
ACCTTCCTTATCCTGGATCTTGGCCTTCACATTGTCGATTGTGTCCGAACTCTCTACCTCCAAAGTGATTGTCTTGCCAGTAAGAGTCTTAACAAAGATT
TGCATACCACCACGAAGACGGAGCACCAAATGAAGGGTGGACTCCTTTTGGATGTTATAGTCTGCCAGGGTACGCCCATCCTCAAGCTGCTTTCCAGCGA
AGATGAGACGCTGCTGATCTGGTGGGATACCTTCCTTATCCTGGATCTTAGCCTTCACATTATCTATGGTATCTGAACTCTCAACTTCGAGAGTGATGGT
CTTGCCAGTAAGGGTCTTAACGAAGATTTGCATCTAATATAACAAACAAACAAACAAACAAATCAGTCACCACCAACTCTTAATTATAATGGCCATTACA
TGGGGAACACAAATAACAAGGACTACATAAATAAACATCTGAAAGGTTATTGATAAAATTTCTCCCAAACACACAACAATATCACTGACAAATCCTCATT
ACAAAATTACATTTATACAACACAAAAACAGACCCTGAATAAAGAAAACGTTCGGAACTAGTTTCCGATCAATGAATCAATAAAACCAAAATATACAGTA
GAAATTTGCATAAAAATATACAATTAAATCTCAATTTGGTAAAATATATGCATACCCACCCCATAATAGATCTCAAGATAGCTCCCTCACATGCATTAAA
TTGGCAAATAAATCAAAACATATTTCATTAAGATCTTCTACGGATTGGTTATTCACAAAAGTAAATCATGACCAACGTTCCAAAAGAACATCAAACCAAA
ACCCTAATTATCAAATCAAAACATCAAGATCGGAGGCCTAAACAAATCCGATTATCTCAGTTCCATCAATTAATAAAGAACTCACAGCCCTAATAATCGA
ATCAGAACACAAAAAACTTCCAGATCTAGATTTTATCGGTACCGAACAACGCAGACTAAGGAATAGAAACAAACCAAAAACAAGAATCAACAAAAAGAAC
AACT