Detailed information on CNT30725966


BLAST search results

BLAST vs Swiss-Prot:
sp|P23322|PSBO_SOLLC, E-value = 5e-99

BLAST vs NONCODE:
NONGMAT000837, E-value = 3e-65

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30196966Lupinus angustifoliusPisum sativum5.2429.5892.9671forward
CNT3023343Lupinus angustifoliusPopulus trichocarpa26.2547.9883.99356forward

Expression of CNT30725966

Peptides detected in this lncRNA

>peptide 1 (42 aa)
SNTKIYIVKPELSIPSPFSKELIPFGFMVAPPNKYRSQESNP*

>peptide 2 (36 aa)
MPSFSSNFTLPSGETSNGPSISSRVSRFGTPSALAP*

>peptide 3 (37 aa)
MTVLHQFGQKTNSKSIRKNNLSMSQAEHTKHLGSSHP*

>peptide 4 (31 aa)
MCLKSNNKTKTNFVKSGTKIITFKILNVIVSF

>peptide 5 (33 aa)
MALRFRRGLAALEHLRHLLPEYLSRIIVTHVTK*

>peptide 6 (30 aa)
MKQHFCCFLCRVLPRLLFHQQAMQLHCHSL*

Sequence

>CNT30725966
CTTCAAATACCAAAATTTATATAGTAAAACCTGAGCTCAGTATCCCCTCACCCTTTAGTAAGGAACTAATTCCTTTTGGGTTCATGGTTGCCCCTCCAAA
CAAGTATCGTTCCCAGGAATCGAACCCTTGACCTTTTGGTCATCCTATGATCTAGGAGGGCCTTACACCACTAGACCAACGACTTGTTGGTGCAGGATTG
TTCTAGTCACTAACATATTACTAGCAATGAGGAATAATTAAGTTGGAATAAAACTCCACAAACAAGTAACCTCAATACTTTAAGCATTATGATATGAAGT
CAATATATAATATACAAACATGACAGTGCTTCACCAATTTGGTCAAAAGACAAATTCAAAGAGCATAAGAAAAAATAACCTCTCTATGAGTCAAGCTGAG
CATACCAAACACCTTGGATCTTCACATCCTTAGGAGCTTTAGCTCCTAAATCAGTGTCAGAAGGCTGAAGACTCTCAAACACGCCGATAATCTCGCCGGT
CTCGGGCTTGGTCTTGGTCACACTCAATGTGATTTTCCCTTTGGATGAAGCAGCACTTTTGTTGTTTTCTTTGCCGAGTTCTTCCTCGTCTCCTCTTCCA
CCAGCAGGCAATGCAACTGCATTGTCATAGCCTGTAGAGGCACCCCTTCCCTTCGGGTCCAAGAAAGACGAACCGCGGTATGATGGTACTAGATACTCTC
CACTGAAGCTATCTGGCTTTCCTGATGCAACCAATTGCTTGATGGTGAAAAGGAACGGGACTCGTTCGCCACCAGGGAGCTGAACTGTAACTGCAGCGTA
GTCAATGCCATCTTTCTCCTCGAATTTCACACTGCCATCGGGTGAAACTTCGAATGGCCCTTCGATTTCGTCGAGGGTTAGCCGCTTTGGAACACCTTCG
GCACTTGCTCCCTGAATATTTATCAAGAATAATAGTCACTCATGTAACTAAGTAGATCAATAGGAGAAATTTGAAGGTGTTTCCTCAGAAAGAAAATGTT
CATGCTCTATAGTCTATACAATTATATAAACATATATATGCATACATTTTATTTCTGTATGCATAAGTACTACTAACACAATTACATAATCATGTGTCCA
TTTTCATGTGATAAACTCGAAAACAATTTCAGACTATTATGAGATTAAATCTCGTGTTAATTCTGATATTCGATCGACGAATCAGATATAAAGTTACAAA
CATATAGTTAGTCCTCTTTCTGCTAAAAAACACACAATTCAGAGAAACCTCTATCCTCATGTGTCTGAAAAGTAATAACAAGACGAAAACTAACTTCGTC
AAATCCGGTACGAAAATCATAACTTTCAAGATCCTAAATGTGATTGTAAGTTTCTG