Detailed information on CNT30725880


BLAST search results

BLAST vs Swiss-Prot:
sp|P69310|UBIQ_AVESA, E-value = 1e-42

BLAST vs NONCODE:
NONSTUT000620, E-value = 9e-18

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30316655Lupinus angustifoliusCorylus avellana39.3884.7689.89267forward

Expression of CNT30725880

Peptides detected in this lncRNA

>peptide 1 (51 aa)
MRRCWSGGIPSLSWILALTLSMVSEDSTSRVMVFPVRVFTKICIVKRQCCGT

>peptide 2 (57 aa)
MHNFENLIKHQLSGTHRSSSYASWRHHGGGGQGGGLIPSGCCSRRGCDRLQAVFRRR*

>peptide 3 (31 aa)
VEHLTHTLTYQTPYNIVCNMISTHAKKHSKT*

Sequence

>CNT30725880
TAGTAGAACATCTCACCCATACACTTACATATCAAACACCTTATAATATCGTATGCAACATGATAAGTACACATGCTAAAAAACATAGCAAAACCTAAAA
CATTGAAAACGCAAAAGCAAATCCACATAAACAAAAGATGTTAACTCCAGCTGATATCTAACAAATAAGTAACTTATTTAACTTAAACATATCACAAATA
AACCAGCACTTAATTAGGTTAAAAAAAGCACCAAAACCAGCATTTAAAACACGAAATATTCAGACAGACAAAAATATAATTGAAAAATTGTCTAACACCA
AATATTCCAAAACCAAAAAATACAATAACTTCGAAATTTAAACGCTAAAAATGCATAATTTTGAAAACCTAATCAAGCATCAGCTTTCTGGTACACATAG
GTCTTCTTCTTACGCTTCTTGGCGCCACCACGGAGGCGGAGGACAAGGTGGAGGGTTGATTCCTTCTGGATGTTGTAGTCGGCGAGGGTGCGACCGTCTT
CAAGCTGTTTTCCGGCGAAGATGAGACGCTGCTGGTCCGGTGGGATTCCTTCCTTGTCTTGGATCTTGGCCTTGACATTGTCGATGGTATCGGAGGATTC
AACTTCGAGGGTGATGGTTTTCCCCGTTAGGGTTTTCACGAAGATCTGCATCGTGAAACGGCAATGTTGTGGCACAAT