Detailed information on CNT30725340


BLAST search results

BLAST vs Swiss-Prot:
sp|Q307Y9|METK1_SOLTU, E-value = 2e-100

BLAST vs NONCODE:
NONATHT001922, E-value = 2e-60

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30358838Lupinus angustifoliusLactuca sativa30.9245.6180.13312forward

Expression of CNT30725340

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MCTPSSIGVDDDLTAGETSIPMRSTNDKTA*

>peptide 2 (46 aa)
MCQQRRIKALAHRWHKTLAQWSSLQVHLQQCSSQLASQCKLHSCQP*

>peptide 3 (33 aa)
MCKKLCNKEHYQHFPFHLLKHLFWPLGQGKLRT*

Sequence

>CNT30725340
ATACACATGTTATAAATTTTGATTAATATTTTTAGTCAACCAATGAAATTATAAATATTTAACTATCACTAACCATATAGCAGTACAATTTTGGATATTA
AATAACATGACAGTAAGTACAGTATGTGTAAAAAGTTGTGTAATAAAGAACACTATCAACATTTCCCTTTCCACCTTTTGAAGCATTTGTTTTGGCCTTT
GGGACAGGGGAAGCTACGGACTTAAAATTAAAGTGCACATGAGCTCATTGAAACAAGGACATCCATATTATACTATATGATTTGAGATCATGAAATATAT
TGGGCATACAAACTGAGTACATTTTTTCTAGTTCAGCAAATAAAAAATTACAAAAAAACTGAGAAGAAAAAACAGAGGGGGTAAAAGAGACACACACAAA
GGCATAGAAAGATTTATAGATTAATCATATTGAAGGCAACCAGCAAAATTCCCAAGCCTAGAGCAATGGAATCACTTAAGCCTTCTCCCACTTGAGAGGT
TTCACCACTTCCCATGTGAAGTCAGCATCATCTCTTCCAAAATGTCCATAGGCAGCAGTTTTCAAGAATCTTTTGTTGCCACCCCTCTTTAGATCAAGGT
TGATAGAGATCATTCCAGGCCTGAAATCAAAGTTCTCTTTCACAATGTTGAGGATCTCCTTATCAGGGATCTTGCCAGTACCATATGTGTCAACAAAGAC
GGATAAAGGCTCTGGCACACCGATGGCATAAGACACTTGCACAATGGTCCTCCTTGCAAGTCCACTTGCAACAATGCTCTTCGCAGCTTGCCTCACAATG
TAAGCTCCACTCCTGTCAACCTTAGTTGGGTCCTTTCCTGAGAAAGCACCACCACCATGTGCACCCCATCCTCCATAGGTGTCGATGATGATCTTACGGC
CGGTGAGACCAGCATCCCCATGAGGTCCACCAATGACAAAACGGCCTGATGGGTTCAAGTGGAAAATGGTCTTCTCATCAAGGTAGAAGATAGAGGAAGA
AATGGGTTC