Detailed information on CNT30725094


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39654|PSAL_CUCSA, E-value = 4e-57

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30516757Lupinus angustifoliusJuglans regia54.4770.178.39347forward
CNT30154501Lupinus angustifoliusPrunus persica24.6550.3284.08157forward

Expression of CNT30725094

Peptides detected in this lncRNA

>peptide 1 (32 aa)
LMHVTVSPLIHATDQFAVELKDRWEMRENLTL*

Sequence

>CNT30725094
TTTGATGCATGTAACAGTCTCACCACTCATTCATGCTACTGATCAATTTGCAGTTGAATTAAAAGATAGGTGGGAAATGAGAGAGAATTTAACATTGTAA
CGGATTGAGTCATAAAATACAGCATATACATCCATCCACCTATTAATTGTTCATTGAGTTGGGGATGAATAACAGAAAGAAAGAAAGAAAGAAAGAAAGA
TAAAAATTGTTTACTTGAAGAAGTATGGAAGGTCTAAGACATAAAGGAGGAAGTAAGCCCAGGTAACACCAGAAATCCCTCCAAAGAAGAAGCCACCAGT
GAACTTGGCCCAACCATCAGCTGTTTGGAGCTGATCAGGAGTGTTCCTTAGAGGTCCGGCCTTCACGAACGGACCGACGAGCAGGAACCCGTGGGCTAGA
CCCACCTCTATCCCCCTCAACAGTGGGCTAACTGCAGTTCTATATGCTGGAAGGTTGGACAAGTACCATGCAACCAAAGGACTTGATGTCACTGGGGTTT
CAAGGCTTCCAATGAATGGGTCACCGTTGATTGGCTGAATCACTTGAAAGGTTGGCTGCCAGTGCAAGTGCATCACCAATTATTAAAGGCAAAAGTATCA
CACATTCATCATTAGCTACTAACTTTATCATAGATAC