Detailed information on CNT30724929


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30270405Lupinus angustifoliusChenopodium quinoa6.4220.585.7191forward
CNT30526301Lupinus angustifoliusPhaseolus vulgaris7.7620.7989.09110forward

Expression of CNT30724929

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MLETMCAYSLSVTTHHHLFTLSFSLAFASFLCLN*

>peptide 2 (36 aa)
MLELTLARFAAILLNTMYIIYLIYSKLGRYVFSILF*

>peptide 3 (30 aa)
MIYVFKILFFYCKVCIYYILVVFLIDRNIL*

>peptide 4 (32 aa)
MQKQIFSLHSLLNINLHSFQVLKLLFAMEFLH*

Sequence

>CNT30724929
GTCTGAGTTAACTATATAGGATTAAGGATTAGTTTGTTATCTCTAAGACTCTAACTAATCCTGCAACCCTTTTCAGAATCCTAGGCAAATCCAATAGCAG
ATTCCATTAATTCTATGAAGGTTAAGGGTAAGAGAGGTGACAGAAGAGAGTGAGCACACATGGTACTTTCTTGCTTGATGATGTTTCATGCTTGAAACTA
TGTGTGCTTACTCTCTATCTGTCACCACACATCACCATCTCTTTACTCTTTCTTTCTCTCTTGCTTTTGCCTCTTTTTTATGCTTGAACTAACCCTAGCT
AGATTTGCAGCCATATTACTCAATACTATGTACATCATATATCTCATATATAGCAAATTAGGAAGGTATGTGTTTTCTATATTGTTTTAACATATAGGTA
CTTCTTATCTCTTACCATGTTAATCTTAACATTTTCTTAATTTCTGCCAATATTTATATGACTATCTGAGGGCACTTATGTGTGATTCACAATTATGACT
ATGATTTTACTCAACTTGGTATGTGTGGAAAAAAGGATAAATCTACATCTTCCTAATAAATCTTCCTAAATATAGCTACTTTTTAATTATTATTATTTTT
GCATTTTCAAGACAATGGAACATTAGCTTTTACATTGGATACTTGCTTTTAAGTAGTATCAGACTATTAGGAAGATTTAGGGATGATCTAGTATAGCTTC
TGTGAAGAAACCTTTCTATTGTTTTGTATTGATAAAATCCAATTATGCTTATATAATAAAATATTATATGTTTCCTTTGGTCAATTTTATATGACCATTT
TGGATAGGTTCACGTAAATAAAGAAAATAGATGTAAAAAAAGATCACATGTAAACATAAAACTTTTTACCCCTAATTTGGGGTTCAGACCAACATGATTA
AGAAGTAAATTGATCAGCAAATCATTTTTTAATTGTTCAATTTTCAAGATCTGATGTTATAGAAGTGGAACATGATTTATGTTTTCAAAATTTTATTTTT
TTATTGTAAAGTTTGTATATACTATATATTAGTTGTCTTCCTTATCGATAGAAACATACTGTAGGGGTTATAAGACATAGTATGCAAAAGCAAATTTTTT
CTCTTCATAGTTTGCTAAATATAAATCTCCATTCCTTTCAGGTATTAAAACTCCTCTTCGCCATGGAGTTCCTGCATTGAAAACTTGTAGAAGAATGAAA
GCTTTAATGATGGGAAATCAAAACAAATATCTGTTTCCAATTTGTGATTAGAATCCCTAACCCTGAGGGAGAGGAGTTATGATGCTTAATTTATATTCCT
AGGGCTGTACACTATGAACTAGATGTATGAGGATGTTTGATTTTTGAAGACAATAGTGATGACTTCAAGATAATAAATATCATATAATATTTTGATCTGT
ATATACATGATACAGAT