Detailed information on CNT30724925


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMTRT001777, E-value = 3e-84

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30724925

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MLRAAALARLSFASTTPFLYPPVLPTFKI*

>peptide 2 (30 aa)
MEETQHAVMHQVMIMYSWVKDQVYQNLKLM*

>peptide 3 (37 aa)
MQMKKKERGLQGAHIRWTCRPIASTFIFRGKNFFTQM*

>peptide 4 (30 aa)
MERYIINKLVCFVGSLPIVSNNVSQIHNPL*

>peptide 5 (47 aa)
MYISSLPFSEIQLVFRRIMVARIELKHYILEALYYHIMNQFSPKCLFK

Sequence

>CNT30724925
ATTTGTAACTCATGCAAATGAAGAAAAAAGAACGTGGATTGCAAGGTGCACATATACGATGGACTTGTAGGCCTATAGCATCAACATTCATATTTAGAGG
TAAGAATTTTTTTACACAAATGTGAAGCATAGAGAAAGTTGATTGATTGGTTCTATTTCTCAGTACAAGTTTCCAAAGTAAAATGAAAAATGGGGCAAGA
AATTTAGTAAGCATACAAAACCATAATGGAAAGGTACATAATTAACAAATTGGTTTGTTTTGTTGGCTCACTTCCAATTGTTAGCAACAATGTCAGCCAA
ATCCACAACCCTTTGTGAGTAACCCCACTCATTATCATACCAAGCAATCACCTTCACAAAATCATCTCCCATTACCATTGTCAATGATGAGTCAATAGTT
GAGGACACATCAGTGCACCTAAAATCTACTGACACAAGTGGCTCATCACAAACTGAGAGAATACCATTCAGCTCCTTATCTGCACTCTCTCTGAAAGCTG
CATTCACTTCTTCTGCGAAAGTCTACAACTGAGACGTTTGGCGTTGGGACACGGAGTGCGATTCCGTTGAGCTTGCCTTTGAGGGATGGGAGGACTAGGG
CCACAGCCTTGGCTGCTCCTGTTGAAGTTGGGACAATGTTAAGAGCTGCAGCTCTGGCACGCCTGAGTTTTGCTTCTACTACACCTTTCTTGTACCCTCC
GGTGCTTCCAACCTTCAAAATTTAAACAAATGTAATGTTGTTAAACAGATCATTAAATATTTAAAGTCATGAGTTCAAATCGTGGAAACAGTCTATCTGC
TTGTCGAGGTAAGGCTGCATATATCTACCATCCCAGACCACACTAAGTGGGAGCCTCGTGCACTGGTCCACCTACTTTTAGGCATTGTGAAAGGCCTAGT
TCAAACACTAATATAACTAGTTCACCATGGATGGAAGAAACGCAGCATGCAGTCATGCACCAAGTGATGATAATGTACTCATGGGTCAAGGACCAAGTCT
ATCAAAACCTTAAGCTAATGTAAGGTGAAGGCTCATGATTACTTTTATATTAGCCATGCTGCAATATGCATAAGAGTCATTTATAGTTTATACCTGAATA
TTGGATATGTACATATCATCTTTACCATTTTCTGAAATTCAACTTGTATTTAGAAGAATAATGGTAGCAAGGATTGAACTCAAACATTACATTCTAGAGG
CTCTATACTATCATATTATGAACCAATTCTCTCCAAAATGTTTATTTAAATG