Detailed information on CNT30724737


BLAST search results

BLAST vs Swiss-Prot:
sp|O49886|CYPH_LUPLU, E-value = 1e-58

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30517653Lupinus angustifoliusJuglans regia22.197.8485.33150forward
CNT30702610Lupinus angustifoliusQuercus lobata19.9725.8685.19135forward
CNT3019668Lupinus angustifoliusCitrullus lanatus13.6121.791.392forward
CNT3071229Lupinus angustifoliusQuercus suber22.1920.3386.67150forward
CNT30632225Lupinus angustifoliusVigna unguiculata19.0826.687.6129forward
CNT30201798Lupinus angustifoliusPisum sativum26.9278.1185.71182forward
CNT30507180Lupinus angustifoliusNicotiana attenuata34.6234.5180.34234forward
CNT30710754Lupinus angustifoliusGlycine max16.2742.3187.27110forward
CNT3043301Lupinus angustifoliusPrunus dulcis20.7119.6487.86140forward
CNT30638631Lupinus angustifoliusCapsicum annuum34.6231.0384.62234forward
CNT3090362Lupinus angustifoliusSolanum tuberosum22.0431.2483.89149forward
CNT3084160Lupinus angustifoliusVigna radiata22.3417.5881.46151forward
CNT30145071Lupinus angustifoliusMedicago truncatula15.0921.9490.2102forward
CNT30312502Lupinus angustifoliusCamelina sativa13.3125.4286.6790forward
CNT3075586Lupinus angustifoliusBrassica juncea15.6820.0486.79106forward
CNT30597524Lupinus angustifoliusFraxinus excelsior13.1741.9888.7689forward
CNT30653963Lupinus angustifoliusRosa chinensis20.7116.8389.29140forward
CNT30624974Lupinus angustifoliusDaucus carota32.2529.9584.86218forward
CNT30686005Lupinus angustifoliusTriticum urartu18.4935.5180.8125forward
CNT30155236Lupinus angustifoliusPrunus persica20.7115.7789.29140forward
CNT30430128Lupinus angustifoliusPapaver somniferum37.7231.2583.14255forward
CNT30706413Lupinus angustifoliusPrunus avium20.7142.4289.29140forward
CNT3022997Lupinus angustifoliusPopulus trichocarpa18.9324.2490.62128forward
CNT3035490Lupinus angustifoliusCucumis melo33.2845.7389.33225forward
CNT30175854Lupinus angustifoliusVigna angularis18.4937.4385.6125forward

Expression of CNT30724737

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MRINLILLKVAHHFMLININHDTDSKTKYSHRLNHNTSQNLKRRLSNITIETKRHRIR*

>peptide 2 (47 aa)
MVTGLEVLPEPDPTFSISLTTLSPSTTLPNTTCFPSSHSVFSVQMKN*

Sequence

>CNT30724737
TTATAAACAGATTGGGAAGTTATTTAAAAAGAATTATTTGTAAATGCGAAGCTTCTTGAAAATTTGGTACTTTTTTTCAGAATCGTTTGATTAACGGTTA
TGAATAAAAATGAAAAGAGTTGATGAGAATAAACCTAATTTTATTGAAGGTAGCTCATCATTTTATGTTGATTAACATTAACCACGACACAGACTCAAAA
ACAAAGTATTCCCATCGACTCAACCATAACACATCACAAAACCTAAAACGACGACTCAGTAACATAACAATTGAAACAAAACGACATCGCATAAGATAAA
ACGACACAAATCAGAGCCACCAAATTAAGTACTGAGTGAGGTCAACATCTAAGAGAGTTGACCACAATCGGCGATGGTAACAGGCCTTGAAGTCTTGCCG
GAGCCAGATCCAACTTTCTCGATATCTCTCACAACGTTGAGTCCTTCAACAACTTTACCAAACACAACGTGCTTTCCATCAAGCCACTCTGTCTTCTCAG
TGCAAATGAAAAACTGAGATCCATTGATTCCAGGACCGGTGTGCTTCTTGATGAAGTTCTCATCAGCGAACTTAGCTCCGTAGATTGATTCACCTCCGGT
ACCGTTTCCGGCGGTGAAATCACCACCCTGGCACATGAAGTTAGGGATCACACGGTGGAAGGAGGATCCCTTGTAA