Detailed information on CNT30724158


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30711384Lupinus angustifoliusGlycine max11.5332.3886.7668forward

Expression of CNT30724158

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MKTKGKELSTRVAVLHPPLNSSFAPFCTYTFA*

Sequence

>CNT30724158
AAACAAGTAGGGGAGGAGTTGTTAACATTTACAATAAATATAATTAGTTAACCAGAAATATTAAGCAGACAAATAAAAATATCAATAGCTTCATCTGAAG
TGGATACTCAATGTTGTAAGGACATACAGCTGCAACTGAATAAAGAAAGGAACAGTTCCAGTGATGCTTGATCACATAATTATATAAGTTTAAAACTTAC
AATAATCTAGAAGTTCCTTGTTTGAAATTTGAATACAAATACAGCACATAATATAACCCTATGTACAAAGCCAATGTGTTATTGAAACTTGACACAGCAT
GTATCAATTTGTATCACAATGGCTGAGATTTATGTGAATAGTTCAGTATGAATGAAAACAAAAGGAAAAGAGTTATCAACTAGAGTTGCAGTCCTTCATC
CTCCCTTGAATTCATCATTCGCTCCTTTCTGCACGTACACATTTGCTTAAACAGCTTAAGCACTGCTTATCTTGTTCTCGGCTCCAACCGAACTGCGGCG
CAAAGCTGGAGTTCGCTTCAATGCCTTCACTCCAAATGGGTTATTGATCTCATCGTCGGTTCTTTGGACGTGGGTTTTGTCGTACGAGAT