Detailed information on CNT30724063


BLAST search results

BLAST vs Swiss-Prot:
sp|C6TAY1|SOMT2_SOYBN, E-value = 1e-15

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30724063

Peptides detected in this lncRNA

>peptide 1 (68 aa)
KAKCGKYLVICEACLLKESLPIVFISLLSIVNSHHSYVKEEFNFCHSMFILLFIYHVLTSANNGVNFLV

Sequence

>CNT30724063
AAAGCCAAATGTGGGAAATATCTTGTAATTTGTGAAGCCTGCCTTCTTAAAGAGTCCCTTCCAATCGTTTTCATCTCTCTCCTTTCCATTGTGAATAGCC
ATCATAGCTATGTCAAAGAAGAGTTTAACTTCTGTCACTCCATGTTCATCTTGCTTTTCATTTATCACGTTTTAACTTCAGCAAATAATGGAGTCAATTT
CTTGGTGA