Detailed information on CNT30724009


BLAST search results

BLAST vs Swiss-Prot:
sp|P50378|EFTU_GONPE, E-value = 8e-14

BLAST vs NONCODE:
NONGMAT000814, E-value = 7e-137

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672753Lupinus angustifoliusSetaria viridis55.9968.9382.4608forward
CNT30629544Lupinus angustifoliusVigna unguiculata60.586.987.21657forward
CNT30564008Lupinus angustifoliusActinidia chinensis49.9171.2283.39542forward
CNT3084119Lupinus angustifoliusVigna radiata72.8444.4485.71791forward
CNT30598511Lupinus angustifoliusFraxinus excelsior43.1972.0485.5469forward
CNT3052982Lupinus angustifoliusAmborella trichopoda54.5145.2680.91592forward
CNT3024873Lupinus angustifoliusPopulus trichocarpa34.8167.0285.19378forward
CNT3037774Lupinus angustifoliusCucumis melo66.7693.7985.66725forward
CNT30496615Lupinus angustifoliusDigitaria exilis57.7369.1383.41627forward

Expression of CNT30724009

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MSLTAKRPRGGYSEKVSTTMGLVGIILTKPASPFFKNLGSFSSSLPDRLSILVKISPNLTAM*

>peptide 2 (42 aa)
MMRSFLLCCSLGDLGSSGILLLHTLDDSNSNSLTHVSHSKTT*

Sequence

>CNT30724009
AAAACTGAAACAACATAAAAGGGAATATAAATGGGATAAATAACCCTTGATTGAAGCAAAAAGTACTGTCAAAAACACAATAGCATGAAAATTGTCCACA
GCCGATCAAGAACCCAGTTTTGAAAACTAGGGCTCATAAATCAGCATAAACTTGAAAACGGAAATGATAAATCAAACACCTAGGACACTGCAAAAGTAAA
ACTAATATAAAGAAACAACACTTTTCTGTAACCAGGACTATGATCACAACAACTGACAGAAGAACGGAGAGCATATGATGCGATCATTTCTTCTTTGCTG
CAGCCTTGGTGACCTTGGCTCCAGTGGGATCCTTCTTCTCCACACTCTTGATGACTCCAACAGCAACAGTCTGACGCATGTCTCTCACAGCAAAACGACC
TAGAGGAGGATACTCAGAGAAAGTCTCAACCACCATGGGCTTGGTTGGAATCATCTTAACCAAACCTGCATCACCATTCTTCAAGAATTTGGGCTCCTTC
TCGAGCTCCTTACCAGATCGCCTGTCAATCTTGGTCAAGATTTCACCAAATTTAACAGCAATGTGAGATGTTTGGCAGCTTCCTTGGCAGGGTCATCCTT
AGAGTTTGAGGCAACAAAACCACGCTTGAGATCCTTGACTGCAACATTCTTAACATTGAATCCCACATTGTCTCCTGGAAGAGCCTCCTGGAGAGCCTCG
TGGTGCATCTCCACAGACTTAACTTCAGTTGTCAGACCAGTTGGACCGAAAGTAACCAACATACCAGGCTTCACGACACCAGTCTCAACACGTCCCACAG
GCACTGTGCCAATACCACCAATCTTGTAGACATCTTGCAATGGAAGCCTGAGGGGCTTGTCTGTAGGCCTCTTGGGCTCATTGATCTGGTCAAGAGCCTC
AAGTAGAGTTGGTCCCTTGTACCACTCAAGGTTGGTGGACCTCTCAATCATGTTGTCACCCTCAAAACCAGAGATAGGCACAAATGAAATTTTGTCTGGG
TTGTAACCAACCTTCTTCAGGTAGGAAGAAACTTCCTTCACGATTTCATCATACCTAGACTTAGAGTACTTTGGAGTAGTGGCATC