Detailed information on CNT307240


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677027Zea maysSetaria viridis45.2762.3386.26182forward
CNT30297575Zea maysTriticum aestivum27.8648.4883.93112forward
CNT30721254Zea maysTriticum spelta27.8620.1183.93112forward
CNT30344884Zea maysEragrostis tef31.5955.2285.83127forward
CNT30365250Zea maysSorghum bicolor49.7562.1193200forward
CNT30551757Zea maysOryza brachyantha14.9320.0788.3360forward

Expression of CNT307240

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MKRFVPPLDNLHAWALHILQTLTYSFLSR*

>peptide 2 (78 aa)
MQQRMTWHCSAAWLLAEKGDNLLSPRGGRCGGVAGGAREVELGAQNLGWSERRHCRRPTIQRKICSKRGWLMGVCGGKG

>peptide 3 (31 aa)
MERAPPLSETHNSEKDLQQKGMADGCLWRERR

Sequence

>CNT307240
AACTTAAGTAAGTAGCATGTCTCAGGCACCAATGGAAGCAGCAGTCATATCACAATCAGAATGAAAAGGTTTGTTCCCCCTCTCGATAATTTACACGCGT
GGGCATTGCACATTCTTCAGACCCTCACATACAGCTTTTTATCCCGGTAAAATCAAAGACGGCATGCAGCAGCGCATGACTTGGCATTGCTCGGCGGCGT
GGCTTCTTGCTGAAAAGGGAGACAATCTTCTGAGCCCCCGCGGTGGGCGCTGCGGTGGCGTAGCGGGAGGAGCCCGCGAAGTTGAGCTGGGTGCCCAGAA
TCTTGGATGGAGCGAGCGCCGCCATTGTCGGAGACCCACAATTCAGAGAAAGATTTGCAGCAAAAGGGGATGGCTGATGGGTGTTTGTGGAGGGAAAGGC
GA