Detailed information on CNT30723701


BLAST search results

BLAST vs Swiss-Prot:
sp|P69325|UBIQP_SOYBN, E-value = 8e-155

BLAST vs NONCODE:
NONMEST001181, E-value = 1e-130

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30615967Lupinus angustifoliusSesamum indicum38.3820.0483.53674forward
CNT30275114Lupinus angustifoliusChenopodium quinoa39.3598.7185.09691forward
CNT30381284Lupinus angustifoliusManihot esculenta39.4173.1583.82692forward
CNT30201346Lupinus angustifoliusPisum sativum38.8466.0984.75682forward
CNT3096867Lupinus angustifoliusSolanum tuberosum39.0178.4785.26685forward
CNT3087979Lupinus angustifoliusVigna radiata39.0772.985.42686forward
CNT30171036Lupinus angustifoliusTrifolium pratense39.0743.8185.28686forward
CNT30609150Lupinus angustifoliusGossypium raimondii39.0164.3883.94685forward
CNT30330398Lupinus angustifoliusDioscorea rotundata38.972.7483.31683forward

Expression of CNT30723701

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MVSELSTSRVMVLPVRVFTKICICEIIRNR*

>peptide 2 (40 aa)
MVSELSTSRVMVFPVKVFTKICIPPLRRRTRWSVDSFWML*

>peptide 3 (37 aa)
MIIWIKESIGLVFSTDLRKFIQIMIIWINKTQKIKKP*

>peptide 4 (53 aa)
MPSLSWILALTLSIVSELSTSRVIVLPVRVFTKICMPPRRRRTRWSVDSFCML*

Sequence

>CNT30723701
GGGATTTTCGCTAAAGTTTGACCAAAACTAACTGAAGACTAACGCAATACAGTAGTGTACACGCCATTGATGCTTCGAAGATAATTTGTAATTTAGAATC
AACACATTCAAATAACATCACTAGTTAACATATTGTGAAGCATAAACCAAATTACGAACAAATTATACAATGGAACTACACTACACATCATAAACGGAGT
TCGGACACAGATATAACCACATTGCAGATATCATAGAACACTACTGAAATTATTTTAAAGGGTCACTAGGGACCCAATAACAAGTTCTGAAATTTAAAAC
AACATGAAAAAGAAACATGCTTTCCATGAAACAAGTTTAGAATCCACCACGAAGACGCAGAACAAGGTGAAGGGTTGATTCCTTCTGAATATTGTAGTCA
GCTAAGGTCCTTCCATCTTCCAGTTGCTTACCAGCAAAGATCAACCTCTGCTGATCTGGGGGGATTCCTTCCTTGTCCTGAATTTTGGCCTTCACATTAT
CAATGGTATCGGAACTCTCAACCTCAAGAGTAATGGTCTTCCCAGTCAAGGTCTTCACAAAAATTTGCATTCCACCCCTGAGACGGAGAACAAGGTGGAG
TGTGGACTCCTTCTGGATGTTGTAGTCTGCGAGGGTGCGCCCATCCTCGAGTTGCTTTCCAGCAAAGATCAACCTCTGCTGGTCTGGAGGAATGCCTTCC
TTATCCTGGATCTTAGCCTTGACATTATCGATAGTGTCAGAGCTCTCAACCTCGAGGGTGATAGTCTTGCCTGTGAGGGTTTTCACAAAGATTTGCATGC
CACCGCGAAGACGGAGGACAAGGTGGAGTGTGGACTCCTTTTGTATGTTGTAGTCAGCAAGAGTGCGACCATCCTCAAGCTGCTTGCCGGCAAAGATGAG
ACGTTGCTGATCCGGTGGGATCCCTTCCTTGTCTTGGATCTTAGCCTTCACGTTGTCGATGGTGTCGGAACTCTCTACCTCGAGAGTGATGGTCTTGCCG
GTGAGGGTTTTCACGAAGATTTGCATCTGTGAAATCATCAGGAACAGATGAATCAATATCACACAGGTAAAAGGGATGAAAAATCAAAACAATCAAAAAA
TACAATAAATTAGAAATCGTTGACTTAAAACGTATTTGTATTTCAACGAATATTTGCATCTACACCTGAACAACAGAACTGTAATTCGAAAGGCACATCA
GATTACCCCTAACAATCTGTTACAAATTAAAATGTTTTCAATGGAATCTAAAATTCAATAATGGATCTGATGAATTTCATTAGGTAATGATGATTTAGAT
ACACAAAAACAAAATCATAGGCTTAATGTTTTTATATAAACCCTAAAATTCAAAAACGGACCTGGGAAATTCACCCAGGTAATGATTATTTGGATAAAAG
AAAGTATAGGCTTAGTGTTTTCAACGGATCTGAGGAAATTCATTCAGATAATGATTATTTGGATAAACAAAACGCAAAAAATAAAAAAACCATAGGCTTT
TAGCTTATTAAAGATATCAGAGAAAACCTAAATGAAAGTGATCCAATCCAAACACAACAATAATAAAAACACAGACATATGAAAGTAAGATTGGATCCAT
AACGCAATCAAAACCCTAATATAAGGAACTTCAAACAGAATTACCGAAAAACCAAAGATCTAATAACACAAAACAAAAGAGAAGAAGGATCGAAGTACCT
TGAAGGATTTGGGTGATTAGAGAAAGAAGAGGTAGTTGATTTGTGAATTGAATTAT