Detailed information on CNT30723549


BLAST search results

BLAST vs Swiss-Prot:
sp|P82658|TL19_ARATH, E-value = 1e-83

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30615625Lupinus angustifoliusSesamum indicum7.4421.8986.4974forward
CNT30379362Lupinus angustifoliusManihot esculenta19.1121.5480190forward
CNT30144998Lupinus angustifoliusMedicago truncatula7.3422.1987.6773forward
CNT30572628Lupinus angustifoliusVitis vinifera14.2928.2980.28142forward

Expression of CNT30723549

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MVAMATAAVKLVRGCLESGMWRSGFGSLRGVGVVAEAVAEEEKSDECDENMVAMAFWICGLSGQVVLSIET*

>peptide 2 (76 aa)
MNMPKNILISIPLRCWSINKMSIKLVISTCHRDQAMSTNPINLIHIINLTLIIFHFLRTQTFSTCNQILQHNIRKS*

>peptide 3 (63 aa)
MSQRSSYEYQPHQSHTHNKLDPYHLSLPQNSNLQHLQSNPATQHQKELNCSKQHLLVQVGETQ*

Sequence

>CNT30723549
ACATCGAATTCAAAAATATATTTTTAATCATAAAATAGTTTACATTTCAACACCTGTAATCACGTAAGTATACCAATCACAACTGCAATTTAAAATATTC
AATAAAATTGAAACCAAACATATAATAATTGACATGGAGTGAAAATTTCAAGAAGATTATCACAGGACACCATCCTTAACATTAAGAAAAACAGAATCAT
TATCTATACCAAAATATATAAAAAACACAATCTAGAATGATCCCACTGTTTTAAAAGACTCATGAACATGCCTAAGAACATCCTTATCTCTATTCCACTC
AGGTGTTGGAGCATTAACAAAATGAGCATAAAGCTTGTTATTAGCACATGTCACAGAGATCAAGCTATGAGTACCAACCCCATCAATCTCATACACATAA
TAAACTTGACCCTTATCATCTTTCACTTCCTCAGAACTCAAACCTTCAGCACTTGCAATCAAATCCTGCAACACAACATCAGAAAGAGCTAAATTGTTCA
AAACAGCATCTTTTGGTGCAAGTTGGCGAAACCCAGTGAGAAAAGTGAGATACTCTTTCTCAGTTTTCTTCTTTGGGTTGTAGAATTCACTATCAGTTCC
ATTAGTACCCTTCTCAACTTTTGACACCAAACGCTCCTTCCACCCTTCAGGCACGTCGTACACGTACTCAGCTGAGTCTTTCTTGCTGGAGTTGCCGCCG
TATCCGCCGTAGTTTGCGGCGCTAGCAGCGGTACCGTAGTAGAGTTGGTAGGTGGTGCGGTGGTTAGGATGGTGGCTATGGCTACTGCGGCAGTTAAGTT
GGTTAGAGGTTGTTTGGAGAGTGGTATGTGGAGGAGTGGATTTGGTAGTTTACGTGGGGTAGGGGTGGTTGCTGAGGCGGTGGCAGAGGAAGAGAAAAGT
GATGAATGTGATGAGAATATGGTGGCCATGGCGTTTTGGATATGTGGGTTGAGTGGTCAAGTGGTATTATCCATTGAAACATGAATGGAACTAT