Detailed information on CNT30723526


BLAST search results

BLAST vs Swiss-Prot:
sp|P62981|RS27A_SOLTU, E-value = 4e-64

BLAST vs NONCODE:
NONGMAT000502, E-value = 3e-35

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30723526

Peptides detected in this lncRNA

>peptide 1 (61 aa)
TLSIRTLLPKPLNLSRIINLIELQQRELHLLMLVLDLLWLGIGLLLTLLGATTEAEDKVEG*

>peptide 2 (54 aa)
MRRCWSGGIPSLSWILALTLSMVSEDSTSRVMVFPVRVFTKICIVKRQCCGTMSG

Sequence

>CNT30723526
ACGCTCAGCATTAGGACACTCCTTCCTAAGCCTCTGAACCTTTCCAGAATCATCAACCTTATAGAACTGCAGCAACGCGAGCTTCACCTTCTTATGCTTG
TGCTTGATCTTCTTTGGCTTGGTATAGGTCTTCTTCTTACGCTTCTTGGCGCCACCACGGAGGCGGAGGACAAGGTGGAGGGTTGATTCCTTCTGGATGT
TGTAGTCGGCGAGGGTGCGACCGTCTTCAAGCTGTTTTCCGGCGAAGATGAGACGCTGCTGGTCCGGTGGGATTCCTTCCTTGTCTTGGATCTTGGCCTT
GACATTGTCGATGGTATCGGAGGATTCAACTTCGAGGGTGATGGTTTTCCCCGTTAGGGTTTTCACGAAGATCTGCATCGTGAAACGGCAATGTTGTGGC
ACAATGTCTGGATA