Detailed information on CNT30723374


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677986Lupinus angustifoliusSetaria viridis7.5921.4195.5267forward
CNT30533222Lupinus angustifoliusEucalyptus grandis9.1724.9295.0681forward
CNT30701352Lupinus angustifoliusQuercus lobata9.2920.7197.5682forward
CNT30376000Lupinus angustifoliusArabidopsis thaliana9.5122.4696.4384forward
CNT3071712Lupinus angustifoliusQuercus suber9.2920.6597.5682forward
CNT30506884Lupinus angustifoliusNicotiana attenuata8.4930.129675forward
CNT3074476Lupinus angustifoliusBrassica juncea9.2920.9792.6882forward
CNT30217757Lupinus angustifoliusKalanchoe fedtschenkoi9.2920.4595.1282forward
CNT30619768Lupinus angustifoliusCajanus cajan9.1732.497.5381forward
CNT30704991Lupinus angustifoliusPrunus avium9.426.8696.3983forward
CNT3024248Lupinus angustifoliusPopulus trichocarpa9.1725.3995.0681forward

Expression of CNT30723374

Peptides detected in this lncRNA

>peptide 1 (35 aa)
VTSIPYNLVSQQPFSSSCVLIFEVKNFIGLCSLAP*

>peptide 2 (36 aa)
MPSVLSISYLLAVRFFILCCMFHVVSLLRFSNEICSG

>peptide 3 (38 aa)
MLLCLSLGFIEFRILCLESHIEYICKVNRVFKQRHSSS*

Sequence

>CNT30723374
AGTAACTTCCATTCCTTACAACCTTGTTTCTCAGCAGCCATTTTCATCTAGTTGTGTTTTAATATTTGAGGTGAAAAACTTTATTGGTCTTTGTTCCTTA
GCACCATGAGAGCCAAGTGGAAGAAGAAGCGTATGAGGAGGCTCAAGAGGAAGCGCCGAAAGATGAGACAGAGATCCAAGTAGTGTGTTTTATCTCCCTT
GCGATGATTAGTCTTTTTTGTTTTTGTTTATGTTTTCAATTCAGACATTCAGAAATTTGTAATACTCTATTTGGTTCATCTAGTTTATGACTTTATGTTG
ATCTTATTTTAAGCTTATATTAGCTGAAAACAATGTTGTTCATCTGCGATTCAAAGGTCTCATTTTTTTGGGATTGATGTTTTGTTGTTCGTTAACTGCT
TCTCCTAGATGTTGCTGTGTCTATCTCTTGGGTTTATAGAATTTCGGATTTTATGTTTGGAGTCTCACATTGAATACATTTGCAAAGTCAATAGGGTATT
TAAGCAAAGACACTCTTCTTCCTAATAGATTAGTCTTTTGGTCGAGTTCTCCTCGTTTTCAAGTCTTAACAATTAGTCTTTTTCATTGAGAGTTGTGCCA
CCAGAAGAGCTACCTAAGCTGGATAAAGCGATATTTCCGCCAAAAGATAGAGTCACCATGGGCTCAGTGCTCAGTAGCCGTCATGGACGTGCAAACATTG
TTAGGAGTCCCACAATGAGTTTGGCTTTTAAGTCGTAACATTTTTAGGTGTATTTTCGATCAACTATTTATATGCCCAGTGTCTTATCGATCAGCTATTT
ACTTGCTGTCCGGTTTTTTATACTATGTTGTATGTTCCATGTAGTATCATTGTTGAGGTTTTCGAACGAAATCTGTTCAGGAG