Detailed information on CNT30723218


BLAST search results

BLAST vs Swiss-Prot:
sp|P09756|CB23_SOYBN, E-value = 7e-123

BLAST vs NONCODE:
NONSTUT001352, E-value = 2e-43

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30723218

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MPRAPSIAHREWITSNSRFLANVSGSAESPAVSQP*

>peptide 2 (44 aa)
MANLPFLSSFTLSSAKASGSSARPNGSKLPPGILWAWIKLGLPK*

>peptide 3 (68 aa)
MDQTWVAQIVKSTLAKDLRTGLEPYSLVKVNTIASQELWEDNAQSSKHSPPRVDHFQLAVFGKCLWVS*

>peptide 4 (35 aa)
MSLGQLKAQQCPNHSHLGIHLSSNLEPHQRVGPST*

Sequence

>CNT30723218
ATAATGATTGAAAAATAATTTACATTAACTTGAATAACATAATAATTCATATTCTTTCAAGAAGTACATTCCTTGAACACATATATTAAACAAATTGAAC
TAAAAGTCATTTCTCGATTATTGGTAGTAAGATTAAGACTTGATTGTTGGTTGTTGTTATTCAATTTCCGGGAGCGAAGTTAGTGGCAAAGGCCCATGCA
TTGTTATTGACTGGATCTGCAACGTGGTCAGCAAGGTTCTCTAAGGGACCCTTACCGGTCACAATGGCCTGAACAAAGAAACCAAACACTGAGAACATGG
CCAACCTTCCATTTTTGAGCTCCTTCACCTTGAGCTCAGCAAAAGCCTCTGGGTCATCAGCAAGGCCCAATGGGTCAAAGCTACCACCGGGGATACTTTG
GGCATGGATCAAACTTGGGTTGCCCAAATAGTCAAGTCCACCCTCGCTAAAGATCTGAGAACCGGCCTTGAACCATACAGCCTCGTTAAAGTTAACACCA
TTGCGAGCCAAGAGCTCTGGGAAGACAATGCCCAGAGCTCCAAGCATAGCCCACCGCGAGTGGATCACTTCCAACTCGCGGTTTTTGGCAAATGTCTCTG
GGTCAGCTGAAAGCCCAGCAGTGTCCCAACCATAGTCACCTGGGAATTCACCTGTCAAGTAACTTGGAGCCTCACCAGAGAGTGGGCCCAAGTACTTGAC
ACGGTCTGGGCCGTACCATGGGCTTCCAGAGGAAACCTTCTTGTTGGAAGTTTTCCTCATGGAGATCCTTCCAATCTCTGTG