Detailed information on CNT30723175


BLAST search results

BLAST vs Swiss-Prot:
sp|P12329|CB21_MAIZE, E-value = 2e-84

BLAST vs NONCODE:
NONMTRT001605, E-value = 2e-71

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30380492Lupinus angustifoliusManihot esculenta31.131.0185.46227forward
CNT30709059Lupinus angustifoliusGlycine max53.1571.8587.37388forward

Expression of CNT30723175

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MANLPFLSSFTLSSAKASGSSARPNGSKLPPG*

>peptide 2 (40 aa)
MDQTWVAQIVKSTLAKDLRTGLEPYSLVKERAIVEAAIFE*

Sequence

>CNT30723175
TTGTTGTTGAAACAGAAATTAGAAATAAATTATCAAAATAAGAAACAAGGAAGACCATAATGATTGAAAAATAATTTACATTAACTTGAATAACATAATA
ATTCATATTCTTTCAAGAAGTACATTCCTTGAACACATATATTAAACAAATTGAACTAAAAGTCATTTCTCGATTATTGGTAGTAAGATTAAGACTTGAT
TGTTGGTTGTTGTTATTCAATTTCCGGGAGCGAAGTTAGTGGCAAAGGCCCATGCATTGTTATTGACTGGATCTGCAACGTGGTCAGCAAGGTTCTCTAA
GGGACCCTTACCGGTCACAATGGCCTGAACAAAGAAACCAAACACTGAGAACATGGCCAACCTTCCATTTTTGAGCTCCTTCACCTTGAGCTCAGCAAAA
GCCTCTGGGTCATCAGCAAGGCCCAATGGGTCAAAGCTACCACCGGGGTAGAGTGGGTCATTGACCTCGCCGAGAGGCCCACCAGCAATTCTATAACCCT
CAACTGCACCCATCAATATAACTTGGACAGCCCATATGGCAAGGATACTTTGGGCATGGATCAAACTTGGGTTGCCCAAATAGTCAAGTCCACCCTCGCT
AAAGATCTGAGAACCGGCCTTGAACCATACAGCCTCGTTAAAGAAAGGGCCATTGTAGAGGCTGCCATATTTGAATGATGGTGATGAGCTAAAGTCTTTT
TTTATGTAAGGATTAGTTATTGGAAGTGAT