Detailed information on CNT30712586


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMTRT001777, E-value = 5e-81

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676566Glycine maxSetaria viridis24.8935.2984.52168forward
CNT30524158Glycine maxSetaria italica24.8922.2884.52168forward
CNT30381182Glycine maxManihot esculenta35.760.7185.06241forward
CNT30628637Glycine maxVigna unguiculata37.6329.6494.49254forward
CNT30123402Glycine maxPhyscomitrium patens21.6318.1683.56146forward
CNT30509382Glycine maxSolanum lycopersicum36.338.3484.9245forward
CNT30243463Glycine maxAvena sativa30.6739.5881.16207forward
CNT302683Glycine maxZea mays18.9631.6882.03128forward
CNT30356846Glycine maxLactuca sativa63.1182.8880.52426forward

Expression of CNT30712586

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MTFTMSSPMTMVNEESTVEDTSVHLKSTDTSGSSHTERIPLSSLSALSLNAAFTSSAKVFFET*

>peptide 2 (30 aa)
HNNLITNENLFGSHFHLLATMSAKSTTLWE*

>peptide 3 (33 aa)
MRICLALTSICWQQCQPNPQPFGSSPIHCHTKQ*

>peptide 4 (34 aa)
MLHSLLLQRSSLRPERRGPPLRRSDKGHCLCCSC*

>peptide 5 (50 aa)
MTLLPTGLTSASKVPRMESTSRSSFQSFQTRLWQPSVLLLSHPSCILHCFQ

Sequence

>CNT30712586
ACATAATAATTTAATTACCAATGAGAATTTGTTTGGCTCTCACTTCCATTTGTTGGCAACAATGTCAGCCAAATCCACAACCCTTTGGGAGTAGCCCCAT
TCATTGTCATACCAAGCAATGACCTTCACCATGTCATCTCCCATGACCATGGTCAACGAGGAGTCAACGGTTGAGGACACATCAGTGCACCTGAAGTCAA
CGGACACAAGTGGCTCATCACACACAGAGAGGATTCCCTTGAGCTCATTGTCTGCACTCTCTCTGAATGCTGCATTCACTTCTTCTGCAAAGGTCTTCTT
TGAGACCTGAACGACGAGGTCCACCACTGAGACGTTCGGACAAGGGCCACTGCCTTTGCTGCTCCTGTTGAAGTGGGGACAATGTTGAGTGCTGCTGCCC
TTGCACGCCTCAGGTCACGGTGGCTCGCATCAAGAAGCCTTTGGTCACCGGTGTAGGAGTGAGTGGAAGGTTGGCAGGGTTGCGGTCAGAAACAACTTTG
ATTTCCTTTCCATCCACGGAGATGACATTGCTGCCAACAGGCTTGACATCAGCATCGAAGGTTCCGAGGATGGAATCCACCTCAAGAAGTTCCTTCCAAT
CCTTCCAAACCCGTTTATGGCAACCTTCAGTTTTGCTTCTGTCACACCCTTCTTGTATCCTCCACTGCTTCCAAC