Detailed information on CNT30712523


BLAST search results

BLAST vs Swiss-Prot:
sp|P48631|FD6E2_SOYBN, E-value = 1e-96

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30375610Glycine maxArabidopsis thaliana44.5427.6781.12249forward
CNT30617145Glycine maxSesamum indicum13.9526.4488.4678forward
CNT3021318Glycine maxCitrullus lanatus36.8523.381.55206forward
CNT30382289Glycine maxManihot esculenta33.4522.3283.96187forward
CNT30524830Glycine maxPhaseolus vulgaris3933.3891.28218forward
CNT30507568Glycine maxNicotiana attenuata43.2932.4882.64242forward
CNT3091031Glycine maxSolanum tuberosum33.998.280.53190forward
CNT30559188Glycine maxActinidia chinensis25.5813.7882.52143forward
CNT30509059Glycine maxSolanum lycopersicum35.2439.0981.22197forward
CNT30146728Glycine maxMedicago truncatula64.7684.1985.36362forward
CNT30314096Glycine maxCamelina sativa43.2949.1980.99242forward
CNT30611984Glycine maxArabis alpina41.534.9478.88232forward
CNT30650498Glycine maxRosa chinensis64.7664.1882.87362forward
CNT30206297Glycine maxHelianthus annuus11.6325.986.1565forward
CNT30626192Glycine maxDaucus carota29.5232.8780.61165forward
CNT30620011Glycine maxCajanus cajan75.3116.7492.4421forward
CNT30154726Glycine maxPrunus persica44.1935.1982.19247forward
CNT30705704Glycine maxPrunus avium44.1912.1981.78247forward
CNT30323306Glycine maxAsparagus officinalis22.3631.4986.4125forward
CNT30120535Glycine maxCitrus clementina20.2125.9883.19113forward
CNT30334294Glycine maxCynara cardunculus22.3612.6480.8125forward

Expression of CNT30712523

Peptides detected in this lncRNA

>peptide 1 (63 aa)
RNIKSQVQGPTKREGDGKSEDSAWWIVKVFRVPHDTGLLLWHKYFISLKRTCVGVVTAMAVFP*

>peptide 2 (28 aa)
MVPASKGQPLTSCWQEEQQFGHQPPSSHN

>peptide 3 (56 aa)
MVTTLMGNDPNTSKDATLDSPIDWPCHERERTGKEVEVMGGNIIEAEGYGEVEWPS*

>peptide 4 (56 aa)
PETLKAKYKGQPSVRVTARVRTLPGGLLRYLEYHMILDFCFGTNTSSRSREPVLEW*

Sequence

>CNT30712523
CCAGAAACATTAAAAGCCAAGTACAAGGGCCAACCAAGCGTGAGGGTGACGGCAAGAGTGAGGACTCTGCCTGGTGGATTGTTAAGGTATTTAGAGTACC
ACATGATACTGGACTTCTGCTTTGGCACAAATACTTCATCTCGCTCAAGAGAACCTGTGTTGGAGTGGTGACGGCGATGGCTGTATTTCCATGAAAAGTA
CGGGACTAGGAGAGCGGAGTGGAGGATAAGGCCAACAATATCATCAAGCAGCTGGTAGTCACTGAATGCATGGTGACCACACTCATGGGCAATGACCCAA
ACACCAGTAAGGATGCAACCCTGGACAGCCCAATAGATTGGCCATGCCACGAAAGAGAGAGGACCGGGAAGGAGGTGGAAGTAATGGGTGGCAACATAAT
AGAGGCAGAAGGCTATGGTGAGGTGGAATGGCCTTCTTAATCTGGCTGAGACTAAACTGAGGTTTTTCAAATGGTACCCGCTTCAAAGGGTCAGCCTCTG
ACTTCCTGTTGGCAGGAGGAACAGCAGTTCGGCCACCAGCCCCCATCTTCACACAATCT