Detailed information on CNT30712487


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMTRT001777, E-value = 6e-81

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30372815Glycine maxArabidopsis thaliana22.6761.7982.66173forward
CNT30196808Glycine maxPisum sativum9.9632.0789.4776forward
CNT30490066Glycine maxOlea europaea22.1518.9584.02169forward
CNT3093146Glycine maxSolanum tuberosum14.8132.6685.84113forward
CNT3059480Glycine maxArabidopsis lyrata10.8834.5887.9583forward
CNT30231796Glycine maxAnanas comosus22.2845.0980170forward
CNT30217937Glycine maxKalanchoe fedtschenkoi13.6324.2484.62104forward

Expression of CNT30712487

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MAMTSRGESLRPCQHLKKFLPILPNPFMATFSFASVTPFLYPPLLP

>peptide 2 (33 aa)
MRICLALTSICWQQCQPNPQPFGSSPIHCHTKQ*

>peptide 3 (34 aa)
MLHSLLLQRSSLRPERRGPPLRRSDKGHCLCCSC*

>peptide 4 (30 aa)
HNNLITNENLFGSHFHLLATMSAKSTTLWE*

>peptide 5 (63 aa)
MTFTMSSPMTMVNEESTVEDTSVHLKSTDTSGSSHTERIPLSSLSALSLNAAFTSSAKVFFET*

Sequence

>CNT30712487
ACATAATAATTTAATTACCAATGAGAATTTGTTTGGCTCTCACTTCCATTTGTTGGCAACAATGTCAGCCAAATCCACAACCCTTTGGGAGTAGCCCCAT
TCATTGTCATACCAAGCAATGACCTTCACCATGTCATCTCCCATGACCATGGTCAACGAGGAGTCAACGGTTGAGGACACATCAGTGCACCTGAAGTCAA
CGGACACAAGTGGCTCATCACACACAGAGAGGATTCCCTTGAGCTCATTGTCTGCACTCTCTCTGAATGCTGCATTCACTTCTTCTGCAAAGGTCTTCTT
TGAGACCTGAACGACGAGGTCCACCACTGAGACGTTCGGACAAGGGCCACTGCCTTTGCTGCTCCTGTTGAAGTGGGGACAATGTTGAGTGCTGCTGCCC
TTGCACGCCTCAGGTCACGGTGGCTCGCATCAAGAAGCCTTTGGTCACCGGTGTAGGAGTGAGTGGAAGGTTGGCAGGGTTGCGGTCAGAAACAACTTTG
ATTTCCTTTCCATCCACGGAGATGACATTGCTGCCAACAGGCTTGACATCAGCATCGAAGGTTCCGAGGATGGAATCGTATTTGAGAAGGTGAGAGGCTT
GTTTCACGCCGCCGGTGTCGTTGATGGCAATGACATCAAGAGGGGAGTCTTTGCGACCGTGCCAGCACCTCAAGAAGTTCCTTCCAATCCTTCCAAACCC
GTTTATGGCAACCTTCAGTTTTGCTTCTGTCACACCCTTCTTGTATCCTCCACTGCTTCCAAC