Detailed information on CNT30712486


BLAST search results

BLAST vs Swiss-Prot:
sp|A9P822|METK1_POPTR, E-value = 8e-158

BLAST vs NONCODE:
NONPOPT000585, E-value = 7e-53

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673153Glycine maxSetaria viridis41.0750.2384.19329forward
CNT30549537Glycine maxIpomoea triloba44.6953.7581.84358forward
CNT30266631Glycine maxChenopodium quinoa67.2961.5379.96539forward
CNT30524774Glycine maxPhaseolus vulgaris54.4360.1491.28436forward
CNT30490001Glycine maxOlea europaea30.8449.883.4247forward
CNT30638840Glycine maxCapsicum annuum70.9166.5182.92568forward
CNT30190465Glycine maxSecale cereale24.2267.3686.6194forward
CNT30225616Glycine maxHordeum vulgare16.7356.0784.33134forward
CNT30218287Glycine maxKalanchoe fedtschenkoi26.5941.0483.1213forward
CNT30626924Glycine maxDaucus carota36.8323.3982.71295forward
CNT30367875Glycine maxSorghum bicolor23.9723.2286.46192forward
CNT30570759Glycine maxVitis vinifera29.3441.8185.96235forward
CNT3055164Glycine maxAmborella trichopoda61.342.781.06491forward

Expression of CNT30712486

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MTKRPEGLRWKMVFSSRYFSGMTGLITCSLRSAAIWSLLTVSSCWVEIRTVWTRTGTMAPLSL*

>peptide 2 (52 aa)
MRATNDKTARRVKVEDGLLIQVLLRNDRLDNMLFKVSSNLVIAHSLIMLGGN*

>peptide 3 (42 aa)
MATPLKVQVNGDHSRSEVEILLHNLKNLLVRNLPSSISVHKH*

>peptide 4 (30 aa)
DIRPMNEVVVVMEHANYSSTPSKTSIEGSD*

Sequence

>CNT30712486
GACATTAGACCTATGAATGAAGTAGTAGTAGTCATGGAACACGCAAATTATTCATCCACACCTAGCAAGACATCCATTGAAGGGAGTGATTAACTTCACA
ACAATCTTAAGCTTGAGGCTTCTCAGACTTGAGTGGCTTCACAACTTCCCAGGTGAAGTCAGGGTCATCCCTTCCAAAGTGTCCATAAGCAGCTGTCTTG
AGGAACCTATGGCCACCCCTCTTAAGGTCCAAGTTAATGGTGATCATTCCAGGTCTGAAGTCGAAATTCTCCTTCACAATTTGAAGAATCTCCTTGTCAG
GAATCTTCCCAGTTCCATAAGTGTCCACAAACACTGACAAGGGCTCAGGGACACCAATGGCATAGGAAACTTGGACAATGCACCTTCTGGCAAGGCCATT
TGCCACAACACTCTTTGCAGCCTGCCTCACGATATAGGCACCACTTCTGTCAACCTTGGTATCAATGATGATCTTTCTTCCAGTGAGACCAGCATCACCA
TGAGGGCCACCAATGACAAAACGGCCAGAAGGGTTAAGGTGGAAGATGGTCTTCTCATCCAGGTACTTCTCAGGAATGACAGGCTTGATAACATGCTCTT
TAAGGTCAGCAGCAATTTGGTCATTGCTCACAGTCTCATCATGTTGGGTGGAAATTAGGACAGTGTGGACACGAACTGGAACCATGGCACCATTGTCATT
GTAGTACTCAACAGTTACTTGTGTCTTGCCATCTGGCCTCAGCCAAGCACAGGTACCATTTTTCCTAACCTCGGTGAGGCGAGCACCGAGTTTGGTTGCA
A