Detailed information on CNT30712203


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9CA67|CHLP_ARATH, E-value = 2e-39

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30270365Glycine maxChenopodium quinoa34.47.9689.5386forward
CNT30403316Glycine maxBeta vulgaris48.820.5785.25122forward
CNT30173457Glycine maxTrifolium pratense66.433.484.34166forward
CNT30654973Glycine maxRosa chinensis48.460.284.3121forward

Expression of CNT30712203

Peptides detected in this lncRNA

>peptide 1 (81 aa)
PFSILRTFNNCLCTHPATLGCKIDPLSRAFGYIASSITNQRHSSRQPSWPRMFRDRVSLHSDDLASQNHPPRTSPQDSRNTP

>peptide 2 (55 aa)
SFFHSQNLQQLPLHTSCHSWLQNRSPLQSIWLHSQQHHQPTPLFPTTFVAEDVPG*

Sequence

>CNT30712203
ATCCTTTTTCCATTCTCAGAACCTTCAACAATTGCCTCTGCACACATCCTGCCACTCTTGGCTGCAAAATAGATCCCCTCTCCAGAGCATTTGGTTACAT
AGCCAGCAGCATCACCAACCAACGCCACTCTTCCCGACAACCTTCGTGGCCGAGGATGTTCCGGGATAGGGTGAGCCTCCACTCGGATGATCTTGCCTCC
CAAAATCATCCCCCACGTACATCTCCGCAAGATTCTCGTAATACACCATC