Detailed information on CNT30712156


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30712156

Peptides detected in this lncRNA

>peptide 1 (77 aa)
FLFFPSFISLSVRFHIAFNLLQVPKWHVIGQWFGSPNSFRMSFVSQLFLGIYYIITRDVSINLYIKCYLSHALLLDI*

>peptide 2 (32 aa)
MVIRKAANLGSNMHVLKGTIFSKKIKGLYLKS*

>peptide 3 (32 aa)
MKKKFEVLNNKDMVSADRNRNTQTVSDYRCSD*

>peptide 4 (44 aa)
MKIVAMALVGFFRFKLANGTPNVTYKVMFTLHMDKGLHLCAIPR*

>peptide 5 (30 aa)
MQRLGEDILHSLKSLWLSKLSRFSRKFPGL*

>peptide 6 (34 aa)
MNQSKSLSIVSLVSFQFQFQFQFGIYISKILFAM*

>peptide 7 (34 aa)
MYRDKNKMPLLRSAQLSGHPCARLKSHLSILQND*

>peptide 8 (36 aa)
MTCLRAEHKSFQLFVLQPHSIIIKKINNIDFIKLFL*

>peptide 9 (34 aa)
MACNRSVVWFSQFFPYVFCISVIPRYILHYYQRC*

>peptide 10 (39 aa)
MFSVCGAYATCCTDLREDLELDLFVYTVYLFMKKFTNFM*

>peptide 11 (39 aa)
MIKYRIFWDQEFNFHFILDHSIYNKKKKKAKILSKSNLL*

>peptide 12 (44 aa)
MCCILCKLMQCVPIFVLIREKCEPGNTVEGTCFYPLNFCYYACD*

>peptide 13 (53 aa)
MLYTLTGKKCPLAFPTYASKSIIIIITVPRQPHSFSLSLFYFWEDKQNEHKAFV

>peptide 14 (44 aa)
MPFGFPHLREQEYHYYHHRTPPTPFILSLSLLFLGRQTKRTQSFC

>peptide 15 (29 aa)
MRFVTLMKKNIYITLLLHQQSIHRNYGCD*

>peptide 16 (29 aa)
MLPNKIIYSSTKLMYNIIYSYIKTANCFL*

Sequence

>CNT30712156
GCTTCCTCTTTTTTCCTTCTTTTATTTCTCTCTCGGTAAGATTCCACATAGCTTTTAATCTGCTACAAGTACCTAAATGGCATGTAATAGGTCAGTGGTT
TGGTTCTCCCAATTCTTTCCGTATGTCTTTTGTATCTCAGTTATTCCTCGGTATATATTACATTATTACCAGAGATGTTAGCATAAATCTCTATATTAAG
TGTTACTTGAGTCATGCATTACTGTTAGATATATAGACAAGTGTATTCAGAATGAAATCATAAATGAAGACTATTAACGTAATGAAGCATAAGCTATGGT
ACAAAGGGATCGAGAAGCCAATAGGGTGCACTGCAACTAGCTAAGTGTACACCACATGTGCTGCATACTTTGCAAATTGATGCAGTGTGTACCCATATTT
GTACTTATCAGAGAGAAATGTGAACCTGGTAATACTGTGGAAGGCACTTGTTTTTATCCACTAAATTTCTGTTATTATGCATGCGATTAGAGCTTGTAAC
TAGTGTGTATAGTATGTACCGTGTAGCACTAGAAGGATGGAACTAGGAATGGCAAAATGAGAGATGAAGAAAAAATTTGAGGTGCTTAATAATAAGGACA
TGGTTAGTGCAGATAGGAACAGGAACACCCAGACTGTGAGTGATTATAGATGCAGCGATTAGGGGAGGATATTCTTCATTCTCTCAAGAGTTTGTGGTTG
AGCAAACTTTCTAGGTTCAGCAGAAAATTTCCCGGGCTTTAAGATCCTTAAAGCTTAGTTCTTAAAGACTTAAAGATAATTGCATTAGTTGCTATTTTTC
TCTGCTGTGTGTCGTTTAGTTTGCTTATGGGACTTGAATATAGAAAATCTAATTGTATGTGCTGTTGCCTTCTTTAGTGTAAATGTTTTCTGTATGTGGA
GCTTATGCGACATGTTGCACAGATTTGAGGGAGGATTTGGAGCTTGATTTGTTTGTGTACACTGTTTATTTATTTATGAAAAAATTTACAAATTTTATGT
GAATTTTCCCATTTGACCTCTACTGGACTGGTGTTGATTTGTTTGAGAAATAATTTTTCCTATTGGATTATGGAATTTCGAAGAGGCTCTATTTTGTATA
AATTTGCGAAGATTAAAGTTGAATAACCTAAAATGGAAGACCTAGCACATGCTTTTTAGGGAGTAAGGAATTAAATCTTATTCAAAGAACAAAAGGAAGA
AATATTTGAAAAGTACAATTATTTGAATTAAAGAATTATAGTTATGTAATTTGAAAGTAACAATTTTAGATTAACATAATATTTTTTTTAATAAGTAAAA
GATTTCATTAGTAATAACAGTGTTTGGTTGAGATGTGTCCAACTCAAAGCTCCCAATAAGATTTTATAAAATATAATCTGTATGATAAGAACTTTTGATT
CAACGCTAAAATTTTAAGATGAAATTATCTTACATAAATTTATTATATAGTGTAAGAATTGATGTAATTTAATGTGTAATTGCAGGCTGGACCTCGTATC
TGCTTATGGGAGGACTTTGCATACAGGCCGATGAAAATAGTAGCAATGGCTCTTGTTGGTTTCTTCAGGTTTAAACTGGCAAATGGAACACCAAATGTGA
CTTACAAGGTCATGTTTACGCTTCACATGGACAAGGGTCTTCATCTGTGTGCAATTCCAAGGTAATGAATAGGGTGACATATGAACCAAAGCAAATCACT
TAGCATAGTATCTCTAGTGTCGTTTCAGTTTCAGTTTCAGTTTCAGTTTGGTATATATATTTCTAAGATCTTATTTGCAATGTGACTCTGCCGTACGTGT
TGCTAGGTGAAGAAGAGATTATCTTCTGGCGTGTTTATAAATGAATACATGTCCATACTCCAAAAGCCTTTTATACCTTTGAGGACTACCATATAATTTG
AATTCAAAGTTGAGTTAGGCGTATCATCTTTGTGTCAAATTGTTTGCATTGCAAATGCCATTATATATTTGATACATTTTATGAATGACATGTCTAAGAG
CAGAGCATAAATCATTTCAATTGTTTGTATTGCAGCCACATAGTATAATCATTAAAAAAATTAACAATATCGATTTTATTAAATTGTTTTTATAAAACTG
ATGTAAAATCTAACCTTCTAAGACGATTTATAAATTGTCATGAAAAATATTAACTTTTCACGACATCGATTTCAAAGACGATCAACTTCAAAGACCATGT
AAAAACATTGTAAAATGCGTTCAATAACCATCTTTAAAATACTTAATTGTAGTATTGATTTCAAGAGAAATTAATTCCTTAAAAGATCAAACTGCAATTT
AGAAGTTTTTTATATATATCAATATAAAAAATAAAAATATCTAGCAAGACCAAATATAATTAATATCTTAGTGAAGGATATATATATATATATGCTTCCA
AATAAAATAATATACTCATCAACCAAATTAATGTACAATATCATATATTCATATATAAAAACAGCTAATTGCTTTTTATAAATGTTTGTAGTTTTAAAAT
AAAGGTATATATGTTATAAAGGTATATATGTTTTTATCTGGTTGTGTATTTATTTATATATGCTTAATTTCTACTTTAGAGTATTTCTATGGTTTTTAGG
CCTGCAAAAATTGGTATAAAAATAAAGGCATGTAAAAAGAGGGACAAGGAGACAAATTAAAGAAGGACATTAGAAGAAACTGTTAACAAAAATCTTATAG
TGAATATTAATATCTTTAAAGGCATGTTCTATAATTGAGCCTAAAGACATGGATCACCTAATGTCTTTATGATTGTAGGATACCTTCTTTAGGTGATCCA
TGAAACTGACAACACAAATTAAACTGACTTGTATACTAATATAACTATATTTTAAAAGCATTAGTCCAGCAAAAAAAATATATTATAAAAGCATTATATA
TATTTTTGTAAATATAGTTACATCAGTATACAAGTCGATCATAGATAATTCTTCTCAACAAAATTAACATAATGAGATTTGTAACATTGATGAAAAAGAA
TATATATATCACACTTCTCCTACATCAACAATCCATTCATCGAAACTACGGTTGTGATTGATCCATATAACATCAGGTGATCACAAGAGTCATAACTTCA
GTTAATAATTTCAAAATTCGAAAAGGCTACTTTCTGGATTAAAAACTAAAGCAAATCACAAACAATTAACACTATTCACAACTAATATATAGATTGTATT
TGATATATTAATTGATAACCTAATAAAGCAATTGGGAAAGAAATAGAGCCTTTAAATTTTGTTGATTGCGAATTGGCATGAACTTAATCTAGATGTGAAT
AAAATAGTGAAAATCACGAACACGTCATTTCCAGGTTGATGGCAGAAAAAACAAGCATAAAATTAAGCAACGAACATTCTGAATTGTGAAGAAGGAACAT
CCAATCATTTCGGTATTTTTACTAATTAAGAATAATTCATAGAGCATAATAGTCAAACATGGAACTAGATCTCTCAAAAACGGAACCTCTATTATAATTA
CTGCAATCATAAATGAAATTATATAGACTACTTCCAACAAAAAGTACTATGAAATAATAACTATAAAATACAAATGTAAAAAACTGCTGATACATTATAT
AGATAAAGGTGCAAGAAAAAGTAACTACAGAAAAAATATAAAAAAAAAATAGAGTCTTACATCATTTATTAACTGCTAATCTGTTTATTTTTCACGAAAG
TGCATAAACAAAATAGAAATATAGACCATCAATAAAATAAAAATATAAAAAGGTACATGAATTAGTCAGTTACCTTAACAACATCAATAGACTCTGCTGC
ATTTTAAATTAATTCTTTCAAGACTTTTAGTATCAACATGATCAATAATGTCCATCAAAACCAATCAACTTGAAATCATGAGATAATTGAATTCACTGTT
CAAAACTGCAGTAATTATTGTTAAATGCTAATGTTAATGGACAATAACTACTTCCAGTCTGCCATTTGTATGTGAGTAATATATTCAAATTGAATTTTTA
TAACGAACGCAAGAACACCTACGTTACAATTAATATAAGGTGTTAAGTGTTAACTAGTCATCGAGCAAAGATTCTTTTGGATTGCTAAGAGAACACTTTT
AAATAACAAATTAAAACTTCATGTATAATATATAGACACTATAAACATGCCATTACTTATCCAACATGACGATAGAAGAACTTATAACAAGTAGAGAATT
CACAGTTATAAGATAGGAGTTATGCTAGTGTCCTTAACCATATCAATTACAACCAACAAGAAATTGAAATTTAATTTTTGAATCCAAGTTGCATACTGCT
GATTATAAGAAAATTAAACACAAAGCTACCAAATTTATTATTTTTCAATATCACATGAACTATACTAAAGCACATAATATACTTTGAAATCAAATTCAAG
TCAATGCTTTCATATCAGAATCAACCCAGAAAAAAATAAAGCAAAACAGCTTGTTCATAGAAAATACATCATTTATCATGATTAAATACAGAATTTTCTG
GGACCAGGAGTTCAATTTCCACTTCATATTAGATCACAGCATATATAACAAGAAAAAAAAAAAAGCTAAAATATTGTCAAAAAGCAACTTATTATAAAGG
TAGTAATTATTTGCTGTGTTTAGATATTTAGCGAACTGTATACCTATATGGTCTCATATATAGCTTGTCCTAAGCACGGGTTAATGAGGAGAGTTATGTA
ATAATCACCTCAATAGTCAATATCAAATTCTCAAATATGAATTACTCACTGCAAATTATGTGTTATAATACCAGGGTAGATTAAGAATTTGATTAAGAAA
AAAAAAACTTGTAAGGATTGCAGGGATGACAATCTCAAAAGAGAAATTTACCATACACAACATAAGGTATTGATCTTTGATATTTGTCTCAAAAGTCCTA
ATCGAAAAATCTGACAAGTTATAAATCAAGAGTCAATTATATTGGTGGTGTCATTAATCATTTATCTAGGAAAAAAGGCTATTGCTTTTGCAAGGTTGTT
TTTAGCTATATTTTTATTTATTTGTAAATATTGGACTATTCAATTTGAATTTGGCTAACCAATACAAGTACAACCGACTTAAAGAGTTTAATTATTAACC
TTTTCAGTAATAAATTGATATATATATGCTTCTTGTCTAGCATAGACACAGTATAAAAATATCAGTACTTTTTCAATATAATTAATTACAAGCAATTATA
CCAATATGCTAGTAGTGTATCAATTACAACAAAGCAGTAATTGAAATTAAATTTCCAATTAGCCCAAATTACTGCTCATAACATAAGACTAACAAAATTC
ATATTAGTTACCAAGAAAGATTCAATTTAAACAAAAAAATAAGGGCTATAGATTGTTCATATAAAATACATTATTTATCAGTTTATGGTCATCAAATACA
GAAAATGTCCTACTAGAACGTTAACACAGTATCATAAAATTCATAATACATAAAAAAAAAAAGAAGAACAAACTTGATCCATTTGACTGTTCGCTACACT
CCTGTTTTCAAATGGGGCATTATTCTGACAAGTTTTGGTGGGTAATGATAAACCCCTATATTCATCAACCTAACTATAGGGTTGCTTCCTAAGAATCAGA
CCACAAAATTGTACTGTTTTAGATATATTGTAACAAATTAAGCCACATACTGTTTCAGGTGAGAACATCTTAGATCACAGCAAAGAACCACACCTCATGG
CCCGCATGCTCTATATACTTAAAAATATGAAATCAGGAAAACGATAATATAGCTAGCTAGAGTGCTAGACGCTAGAGAGTGAACAACACAACCTGTGTGG
ACCATACTATATAACGTGAATGGTCCCTGCCACCACTCGCTAGCATACAAAATACACATGTATAGAGATAAAAACAAGATGCCCTTATTAAGATCTGCAC
AGTTATCAGGACACCCTTGTGCAAGGTTAAAGTCACACCTATCCATTTTGCAAAATGACTAGTATATACTATAAACCATAATAAAGCCAATCTATGAACA
AGTTTGTGTGTGTGTGTTCAACTAATGGCAAATGCTAATAAATACCTAAGGTCACTAGTTAAGAAAGTAAGAGTAGAAAGTTTTTTTTTTTATTAGGAGG
TATACATTTGCATTTTTTTTTATTTTTTTACTTTCTCCTATAATTTACACATTAAAACTTTTTTCTTTTAATTCATTAATCAATGCCCTTAGGGAATTAG
TTAGCAAAACCCTAATAGTAATAGTTAAAGGCAAATGCTAATTAACCTGTTCTTAGGACATTGAGAAAGGAGAAAAATAAAATTGTATTATTTATGACTT
TTTTATGTTTTTGTATGATTTACATAATAAATATTTTCTTATTTCAGTTCCTTAATCAATGTTAGCAAGATCCATAGTTAAAAGTTAAAATAAAATAAAA
GCATACTTATTTCAAAGCACCAAAGCCATATACTATAACTTTTTTTTCACTGTTGAATAATAATGAAATATATATATATATATATATATATATATAGATA
TAACCTGTTTCAGTAAGAGACATTTCTCATGAGCTCCATCAAAATGAGAGAGAGAGAGAGAGGATGATGTGATTTAGTTTATGAAGAAACTTAGTAGACT
TGGAGAATTTTCTGGTACATGAAAACCGACAGAAAGAGTAGTGAGCACACAAAAGCAGTGATATAGATTTATATCAAGTGCCTCTTTGTGCTCACTCTCT
TCTGTCAATTTCTGTCCAAATAGAAGGAATCAAAGATACCAAGTACACATACAATAGCTTCCCAAATATGGAAAGTTCACAGAATAAAAGGTATACAAAA
ATGAAAAATCTGAAGGGAAATAACTCATAACTGGGTCAGATCTGAGGGAGAAAATGCAATATCCTTTGATGGAAAACATCATGAAATATGGTGATAAGAA
AAGCAGCAAATCTAGGATCTAACATGCATGTTCTCAAAGGAACAATTTTTTCCAAGAAAATTAAGGGTTTGTATCTAAAGTCCTGAGATACAAAGAGAGA
GAGAGAAACAAGAAAAAACAAACATCATGGAAGATGCATCAGCAGATGAGGAAGGTAGATCAACAAAAGAGGAAAAGATTTTGAGAATAAATTAAATAGA
AAAAAAAAGACAAGGACCATAAACTCCAACCAAAACCACGTTGGGAAACAAAAAACTCTCTCTCTCTCTCTTCATCTCTGACTTTCTGTACATGGAGTCA
GAGAGAGTCATGCAAAACGTATAGATGACAAGTAGCTAGTTAGCTAGCCAGATCGGTGTGACTGATCTATATATATGCATAGAGGGGTGTGTTATTATCT
GAACTGAATCAATTTTGGAGTGGAAAAAACAAAGAGAGAGTGCAATGAGGTAAGGAGCAAAGCAAAGTTGCACCTAGAGTTAGCTATCTTATCCTATCCA
ACAAGAAGAAAAGAATGAGGATGAGGCCTTTAGCTTAAACCAACACAAATTAAAAAGGAGCAGCCTTTTTGGTTGTGGTTTGTGTGGGAGAGAAGGTGGG
AGAGTGATAGATATATACTAGTTTAATGCTATACACTCTCACAGGAAAAAAATGCCCTTTGGCTTTCCCCACTTACGCGAGCAAGAGTATCATTATTATC
ATCACCGTACCCCGCCAACCCCATTCATTCTCTCTCTCTCTCTTCTATTTTTGGGAAGACAAACAAAACGAACACAAAGCTTTTGTC