Detailed information on CNT30712080


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONGMAT001703, E-value = 4e-162

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521302Glycine maxSetaria italica47.123.1585.92341forward
CNT30525464Glycine maxPhaseolus vulgaris30.6639.2991.89222forward
CNT30629544Glycine maxVigna unguiculata39.9238.2389.27289forward
CNT30637620Glycine maxCapsicum annuum38.9514.6985.46282forward
CNT30224723Glycine maxHordeum vulgare47.148.9983.28341forward
CNT30564256Glycine maxActinidia chinensis46.9629.2186.47340forward
CNT30588719Glycine maxMusa acuminata34.9459.3984.19253forward
CNT30614172Glycine maxArabis alpina46.963484.12340forward
CNT3011290Glycine maxZea mays46.9624.7385.88340forward
CNT30706335Glycine maxPrunus avium50.4132.4484.11365forward
CNT3052982Glycine maxAmborella trichopoda36.0519.9583.91261forward
CNT30580076Glycine maxEchinochloa crusgalli28.4515.5787.86206forward
CNT30116376Glycine maxOryza nivara34.6746.2285.66251forward
CNT30176122Glycine maxVigna angularis47.6530.4890.14345forward

Expression of CNT30712080

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MSLTANLPSGGYSEKVSTTMGLVGIILTKPASPFFKNLGSFSSSLPDRLSILVMSSANLTAM*

>peptide 2 (46 aa)
GFRQTQHIKTQINKSNFATVDQEPSSGNNSCEMMPARFTSSSGQPW*

>peptide 3 (52 aa)
MMMTWAVKMCLCKRFMLVQKSPPFQASRHRSQHVPLAQFQYLQSCTHPEGEA*

Sequence

>CNT30712080
GGGGTTCCGACAAACACAACACATTAAAACACAGATAAATAAAAGCAATTTTGCCACCGTCGATCAAGAACCCAGTTCTGGGAACAACAGTTGCGAGATG
ATGCCCGCACGATTCACTTCTTCTTCTGGGCAGCCTTGGTGACCTTGGCTCCGGTAGGATCCTTCTTCTCAACGTTCTTGATGACTCCCACAGCAACAGT
TTGACGCATGTCCCTAACAGCAAACCTACCAAGTGGAGGATACTCGGAGAAAGTTTCAACAACCATGGGTTTGGTTGGAATCATCTTAACAAAACCAGCA
TCACCGTTCTTCAAAAACTTGGGCTCCTTCTCAAGCTCTTTGCCGGATCGCCTGTCAATCTTGGTCATGAGTTCAGCAAACTTGACAGCAATGTGAGAAG
TGTGGCAGTCGAGGACAGGGGCATAGCCATTTCCAATCTGACCAGGGTGGTTCATGATGATGACTTGGGCTGTGAAGATGTGCCTCTGTAAGAGATTCAT
GTTGGTGCAAAAGTCACCACCATTCCAGGCTTCAAGACACCGGTCTCAACACGTCCCACTGGCACAGTTCCAATACCTCCAATCTTGTACACATCCTGAA
GGGGAAGCCTGAGGGGCTTGTCAGAGGGCCTCTTGGGCTCACTAATCTGGTCAAGTGCATCAAGCAGAGTTGGACCCTTGTACCAGTCAAGGTTTGTGGA
CCTCTCAATCATGTTGTCTCCCTC