Detailed information on CNT30712037


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30630515Glycine maxVigna unguiculata5.5325.9484.2176forward
CNT30588616Glycine maxMusa acuminata7.1340.1685.7198forward
CNT30143899Glycine maxMedicago truncatula5.3836.6390.5474forward
CNT30599767Glycine maxFraxinus excelsior7.7825.9185.05107forward
CNT30218447Glycine maxKalanchoe fedtschenkoi5.3824.1886.4974forward

Expression of CNT30712037

Peptides detected in this lncRNA

>peptide 1 (88 aa)
MYSNALFINPPLQPESHAPYSSGSHWERFIAVNSSLYIRMVANFSIILLSYDLDTSATLQEQRNAINLKIIGYNTVILQHSQQIQIFI*

>peptide 2 (43 aa)
MDSPFLSVLPQTEVCTQMRCSSTHHYSLSHTLHILLDHTGRDS*

>peptide 3 (32 aa)
MSNMDTAIILKFVSLRTGTSCLNVSLCVQNYL*

>peptide 4 (34 aa)
MYHYVFKIIYKHVIGIKQLFSKSNAFHFQSYTNI*

>peptide 5 (30 aa)
MLFISNHTLTYETHSNHVQQFHNNACMDSL*

Sequence

>CNT30712037
CTTAGCAGTTTCCTGATCCTATACGGAGATAATTTTACCAGTACCAAATGATAAAGTTCACAACATAAATATTTATACAAACTCCCCTTAGTCCAGTATC
ACATCACAACCACAATCAGGCATATCTTTGTATTTAATGGCTGGATGGATATATAGCAGCTACAGTTGAGACCATGGAATCTACTCCACACACATTTCGA
CCTCTGCAGATCTTGTAATATCCATTCTCTCCCCAGCTCTCGCCCCATGAATTCTTAATGATCCAGTAAGGTTTGTGCCATCTCTCCCGGTGTATGGATA
GTCCTTTTCTTTCTGTACTCCCCCAGACTGAAGTATGTACTCAAATGCGTTGTTCATCAACCCACCATTACAGCCTGAGTCACACGCTCCATATTCTTCT
GGATCACACTGGGAGAGATTCATAGCCGTTAATTCATCATTATATATCAGGATGGTGGCTAATTTTTCTATTATTTTACTGTCTTACGATCTAGACACAA
GTGCCACATTACAAGAACAAAGAAATGCAATAAACTTAAAAATTATAGGGTACAACACAGTTATATTACAACACTCACAACAAATACAAATCTTCATTTA
GAAAAGAAAATTGAAATTCGAACATCTAATATCATATTCATCCATGTTCTATCAGATACCATTATATATCTTATTATTATGGAATTCATTAATATTAATA
TAATAGTAGAGAAAAAACAGTAAAAAAAATAAAATTGTACAACACAGTTAATTATATCTGGAATGTCCAATCTGGAAACATGTCTAACATGGATACGGCA
ATTATTTTGAAGTTTGTTAGCTTACGGACGGGCACATCGTGTCTTAATGTATCATTATGTGTTCAAAATTATTTATAAGCATGTAATCGGAATAAAGCAA
TTATTTAGTAAAAGCAATGCTTTTCATTTCCAATCATACACTAACATATGAAACACATTCAAATCATGTACAACAATTTCATAATAACGCGTGTATGGAT
TCACTTTAGATGATTCCAAATCACCTTGAAATAATTAGCTAACTCGACTTTAGATGTTCACCTGTTTGATCCTAGGTTGAAAAAAATGATTCTCGGATCC
ACAATCGAATTTGAGTTGAAGCAATTTAAGTAACTTTAATGTTGGACAAAAAATATTGATCTTTGAATTTGCCACTTAACACTATTAGACTAAAACATGT
AAACATAAATCACTTCACTTTAAAAACAATTATAATCAAAATCAACATTCCAAACATTAACCTACCAACTTATTAGTGTTAGTATTAATAGGAATAGCAA
GTTCAAAAAAAAAAGAAATTCATCCAAAAATCAATTTTCGAAACATTCACCTACCACTTTATAGTATTAATGAAT