Detailed information on CNT30712014


BLAST search results

BLAST vs Swiss-Prot:
sp|P05993|PAPA5_CARPA, E-value = 5e-10

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30511822Glycine maxSolanum lycopersicum4.7420.3486.6760forward

Expression of CNT30712014

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MDCSLLDNYASVILNLPILLLLCNRHTSKFMKEIN

>peptide 2 (33 aa)
MINEHMINSFSIRCIGNNENKWIREEKNNNTFG*

>peptide 3 (60 aa)
MVKIFMLRAALCEEGGSASSWCFSPSSSLLLHHWLLLHVHISLNCLSTADLVLTSEGQQL*

>peptide 4 (32 aa)
MRKFYQYRVNMMWRMTWRISRLARAKPLTTHD*

Sequence

>CNT30712014
CATTTGGAATTTGAATACAAATACAGTGCATCGATAATATAACCCTATGTACAGAGCCAATGTCTGACTGAAATTTGATACAGAACATTATCTATTTTGT
ATCATAATAAAATGGTAAAGATCTTTATGTTACGTGCAGCATTATGTGAAGAAGGGGGAAGTGCATCCAGCTGGTGCTTTAGTCCTTCGTCTTCCCTTTT
ACTTCATCATTGGCTCCTTCTGCACGTTCACATTTCCTTAAACTGCTTAAGCACTGCTGACCTTGTTCTTACGTCCGAAGGGCAGCAACTGTAGTGGTCA
TCACAGCAGGAAGCACCCTCAAGAGGACAGCAACCCCACTCGAAGCAAGCATTTCCGAACTCAAAAATACAGCAACAAGTAGCACTATCAGCACAGCTGT
AGTAGTTGTCACAGACATTTGGCGGCTTCACAGGTGAAGGGGGTGATGGTCCAGGATTAGGGGGATTTGGACCATTCTTAAGGGGATAAGATGGCTCAAT
TGCAATTCCACACTTGCCTGATCTGCTGTTAGCAAGATTTCTTTCTAATCTGATGTAGCCATCCTCTCCCCAGCTAGAACCCCATGAATTCCTTACGATC
CAATAATCATGACCTTTAGCTGTTCCATACCCAACAGCCACGACACCATGATCTAGTGCTGTGCCACATCTCCCCGTGAATACACCCTGACAAAAAATGA
AATATACTAATGAGAAAATTTTATCAATATAGAGTAAATATGATGTGGAGAATGACTTGGAGGATAAGCCGATTAGCTAGAGCAAAACCACTTACCACAC
ATGATTAATGAACATATGATAAATTCGTTTTCTATCAGGTGTATAGGTAACAATGAGAATAAATGGATAAGAGAAGAAAAGAATAATAACACATTTGGAT
GAGTGATATATTAATTTTTTCAAATTGATTTTGTTAAAATTGGGTTAAGAAAGAAAGTGATTAAGTTTAGAAATTTATATCAAAAGCAAGTATGTGATAA
AATTTAACGGAGAATTTTTTACTAACTTCAACTCAAACTTGCTTGTAGAACTACACTTGATTTTGAGTTGATGCATTTGCACAATCCAATTTAAGTGCTG
CACTGAACTCACGTTTTAGTGGTGAAACACCCCTCAAAACATTAAATATAAAAAATCCACAATGGATTGTTCATTGTTAGATAATTATGCTTCAGTAATT
TTGAATCTTCCCATTCTACTTCTTCTATGCAATAGACACACTTCCAAGTTTATGAAAGAAATTAATT