Detailed information on CNT30711584


BLAST search results

BLAST vs Swiss-Prot:
sp|O23755|EF2_BETVU, E-value = 2e-102

BLAST vs NONCODE:
NONGMAT000778, E-value = 4e-137

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674834Glycine maxSetaria viridis24.7227.1587.93174forward
CNT30532843Glycine maxEucalyptus grandis31.5330.3385.14222forward
CNT30316236Glycine maxCorylus avellana35.0953.8187.04247forward
CNT30547574Glycine maxIpomoea triloba24.8649.388175forward
CNT30512729Glycine maxJuglans regia5034.2184.09352forward
CNT30373394Glycine maxArabidopsis thaliana35.6544.6682.47251forward
CNT30276060Glycine maxChenopodium quinoa34.3838.1786.78242forward
CNT3019597Glycine maxCitrullus lanatus34.3832.3583.88242forward
CNT30379936Glycine maxManihot esculenta36.7977.5485.71259forward
CNT30405823Glycine maxBeta vulgaris17.7627.7889.6125forward
CNT30488117Glycine maxOlea europaea22.8732.9985.71161forward
CNT3045373Glycine maxPrunus dulcis35.5131.8985.2250forward
CNT30191304Glycine maxSecale cereale49.7226.985.43350forward
CNT30300473Glycine maxTriticum aestivum5036.3685.8352forward
CNT30224354Glycine maxHordeum vulgare49.2966.8683.57347forward
CNT30395070Glycine maxTriticum turgidum49.7245.7582.57350forward
CNT30561656Glycine maxActinidia chinensis36.5118.3685.6257forward
CNT3085191Glycine maxVigna radiata35.9435.2990.91253forward
CNT30510505Glycine maxSolanum lycopersicum43.0427.985.15303forward
CNT30552635Glycine maxOryza glaberrima84.6657.4282.38596forward
CNT30143941Glycine maxMedicago truncatula34.9454.9187.4246forward
CNT30440797Glycine maxAegilops tauschii84.6681.8783.22596forward
CNT30313757Glycine maxCamelina sativa31.5325.3184.68222forward
CNT3059659Glycine maxArabidopsis lyrata31.1150.4680.37219forward
CNT30612508Glycine maxArabis alpina36.6510.1782.56258forward
CNT30135610Glycine maxLolium perenne30.1125.0685.38212forward
CNT3014085Glycine maxZea mays78.6990.8281.95554forward
CNT30605685Glycine maxGossypium raimondii5046.0784.94352forward
CNT30683923Glycine maxTriticum urartu49.7238.2583.14350forward
CNT30722731Glycine maxTriticum spelta31.2543.0580.45220forward
CNT30345702Glycine maxEragrostis tef34.830.3284.9245forward
CNT30361520Glycine maxSorghum bicolor35.3736.483.13249forward
CNT30596122Glycine maxOryza meridionalis39.9140.6183.99281forward
CNT30369654Glycine maxOryza glumipatula49.2939.4384.73347forward
CNT30154011Glycine maxPrunus persica8.6621.7188.5261forward
CNT30107537Glycine maxOryza longistaminata67.6151.884.24476forward
CNT30332479Glycine maxDioscorea rotundata9.824.3891.369forward
CNT30149525Glycine maxBrachypodium distachyon16.4838.4181.9116forward
CNT30100253Glycine maxOryza rufipogon84.6654.0882.38596forward
CNT30575129Glycine maxOryza barthii84.6673.2282.21596forward
CNT30497701Glycine maxDigitaria exilis41.1989.2384.48290forward
CNT30116094Glycine maxOryza nivara84.6667.7382.38596forward
CNT30604019Glycine maxOryza punctata46.5997.0484.76328forward
CNT3050899Glycine maxCucumis sativus19.0353.1785.82134forward

Expression of CNT30711584

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MALMFSSAKAPSFDAHWNPATTESLISFKYWTPLHISTTMLGPRVSGPKHQIFLARSLSQPNSSDKILERIL

>peptide 2 (34 aa)
MGQKTSYPSDQRHIVGKPGLMLQPSMCSRNQRTQ*

Sequence

>CNT30711584
AAAACCACAAACAAAACTCGACAAAACTTAAATCTTAAGTAACATTGTTCATATGAGAAATAAATTCGGCTAAGTTCAAAAGTAAGTTAAATAGTTCAAA
CAATTTAAAGCTTGTCTTCAAACTCGGAGAGAGGAGTCATCTGTTCCTTCAAGCCCTTCCTCTTGCGGATGTCGGTGACAAGCTGTGCAGCTTGTGATCC
AGCCTCCAATGGGTCAGAAGACATCATATCCCAGTGATCAAAGACACATTGTGGGAAAGCCTGGCCTGATGTTGCAGCCCTCAATGTGCTCGAGAAACCA
AAGGACTCAATGACAGGGAGGTATGCTTTGATGTTGTAAAGTGGGGTACCAGGTAGACAGGCTCAAGAAGCCTGGGTTTGGCAGTAATCTGGGAAGCATA
GAAGACTCTCCTGGCAGTAGGGATGATTTGACCACCTCCTCTGTGGATAGCATCAGCGTGCAGAACAACATCACATACTTCAAAGCAAATGGCTCTCATG
TTTTCTTCGGCCAAAGCACCTTCTTTTGATGCCCACTGGAATCCAGCAACCACAGAATCCTTGATTTCATTCAAATACTGGACTCCCTTACACATATCAA
CCACCATGTTGGGTCCAAGGGTCTCAGGGCCAAAGCACCAGATTTTCTTGGCGAGATCCTTGTCCCAACCAAACTCTTCTGACAAGATCTTGGAGCGAAT
CTTG