Detailed information on CNT30711572


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30700162Glycine maxQuercus lobata14.3426.3585.5483forward
CNT3087575Glycine maxVigna radiata24.747.3593.01143forward
CNT30620434Glycine maxCajanus cajan30.2230.4990.29175forward
CNT30175937Glycine maxVigna angularis29.1932.3891.12169forward

Expression of CNT30711572

Peptides detected in this lncRNA

>peptide 1 (58 aa)
DPLLIYKHKPDIDHQSKLVCFVYLVKRELPSLIRTNTLPPSPLEIRNSSSRYVVSNQD*

Sequence

>CNT30711572
AGACCCTTTACTTATTTATAAACATAAGCCTGATATTGACCACCAAAGTAAACTAGTTTGTTTTGTTTATCTTGTCAAAAGAGAGCTTCCTTCTTTGATA
AGAACAAACACACTGCCACCATCGCCCCTTGAGATACGCAATTCTTCGTCGAGGTATGTGGTGAGTAACCAGGACTGAGCATTGCTGTTGGAAATTGGGA
TCTTCAAGGGAGGCCTTCTTCAGCTTCTCCGTCTCCGTCTCCGACTTCGTCGGTTTCTCCTCCACCGCTACGCCGCCGCCGTACGCCTCCTCCTTCTCCG
GCCCCCACTCGTCGTCGCTCGTGACCGCTCGGACACGCACCAGTAGCCTCGGCCTTCCGACAGGTTTGGTCCAAATTCCGACGCTGCTGCGTGGTGGCGA
AATAGAGGGTGAAGAGTTGAGCGGGGGTGAGAGAGAGACGCCATTGTTCAGAGAATAGAACAGAACCGAACGAAACTGAGAAGGGAAGTGCTGGATTTTA
TAACGACAGCTGAGGTTTGAGAAATTCATTGTCCTAACTCCTAAGCGTTGACGACGTTGTAAAATGAAAAGAGTGTGGC