Detailed information on CNT30711113


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SU35|ERLL1_ARATH, E-value = 1e-12

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30711113

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MTWVVDMVLVVCEPVVSQREAFLEAWEKGKGNRDKQEH*

>peptide 2 (85 aa)
MGMMILMLRILALMVVQRHTAASKSTSPASTGQQVCWALLPMPMCMRPPSTSTHAPSFRVSMGHVGCAGGGYGTTGGGGVGTTGG*

>peptide 3 (76 aa)
TLESIWWGLATVNEKLKSNGDDDIDVKNLSPNGCAEAHSSIQVHKPCKHRTAGLLGTAAYANVYEATKHIHTCPQF*

>peptide 4 (48 aa)
MPPVLGCRWGMLVVLVVGMAPLVVVVLAQLVDKQLVVSQWVVLAHKVV*

>peptide 5 (42 aa)
MGMHWRLWMRFWDMGWMWMNWWFRVVRRFWNIGRVYMGWFWR*

Sequence

>CNT30711113
CACACTTGAATCCATCTGGTGGGGTCTTGCCACAGTCAATGAGAAGCTGAAGAGCAATGGGGATGATGATATTGATGTTAAGAATCTTAGCCCTAATGGT
TGTGCAGAGGCACACAGCAGCATCCAAGTCCACAAGCCCTGCAAGCACCGGACAGCAGGTCTGCTGGGCACTGCTGCCTATGCCAATGTGTATGAGGCCA
CCAAGCACATCCACACATGCCCCCAGTTTTAGGGTGTCGATGGGGCATGTTGGTTGTGCTGGTGGTGGGTATGGCACCACTGGTGGTGGTGGTGTTGGCA
CAACTGGTGGATAAACAATTGGTGGTTTCACAATGGGTGGTTTTGGCACATAAGGTGGTGTAACAATTGGTGGTTTTGGCACAACTGGTGGATAAACAAT
TGGTGGTTTCACAATGGGTGGTTTTGGCACATAAGGTGGTGTAACAATTGGTGGTTTTGGCACAACTGGTGGATAAACAATTGGTGGTTTCACAATGGGT
GGTTTTGGCACATAAGGTGGTGTAACTGGCACCACTGGTGGTTTAGGGACATATGGTGGTGTAACTGGCACCACTGGTGGTTTAGGGACATATGGTGGTG
TCACAACTGGTGGTTTAGGGATATAAGGTGGTGTAACTGGCACAACAGGCGGTTTTGGGACATAGGGAGGGTTCACAATTGGTGGTTTTGGAACATATGG
TGGTGTAACTGGCACAACTGGTGGTTTTGGGACATAAGGTGGATGGGGATGCACTGGAGGCTTTGGATGAGGTTTTGGGACATGGGGTGGATGTGGATGA
ACTGGTGGTTTAGGGTAGTGAGGAGGTTTTGGAACATAGGGAGGGTGTACATGGGGTGGTTTTGGAGATGACTTGGGTGGTGGACATGGTTTTGGTGGTT
TGTGAACCGGTGGTTTCACAACGGGAGGCTTTTTTGGAGGCTTGGGAGAAGGGTAAGGGCAATAGGGACAAGCAAGAACATTGAGCAAAGTGCTCAAGTT
CAAGAGAAGGACCAAGAGGATATTGGCTAGGGCAAACTTTCCCATGAGAAAGATTGAGGTAAGTAGCTAAACTAGGGAAAGGGGGAATATATGTTTGAGT
AGTGAAGATACAATGAGGGGCCTTTAT