Detailed information on CNT30711018


BLAST search results

BLAST vs Swiss-Prot:
sp|F4KA51|LRL23_ARATH, E-value = 3e-38

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30315005Glycine maxCorylus avellana26.257.3383.97131forward
CNT30701804Glycine maxQuercus lobata26.8529.9883.58134forward
CNT3047926Glycine maxPrunus dulcis16.0328.8883.7580reverse complement
CNT3085819Glycine maxVigna radiata78.9630.0585.79394forward
CNT30143980Glycine maxMedicago truncatula71.1490.7986.2355forward

Expression of CNT30711018

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MSPSSISTTLFIEGRSLGFNCIHQSETMIIFFAILFSSSVTPSISISVSFPS*

Sequence

>CNT30711018
GTGCATTATCAAATAGTATCCTCTACCAAAGGATTAGTCACGATTTCCTTGGAATAACTAGAAGAACTAATGAAGTCCGTTGACATTGTTTGACTAGAGT
AGATGCTTTGATCATTTTCCATTGTCTCATGTGGATATAGAGAAGGCTTTGGAGGTATTTCCAGGCTTTCAATGTCTCCTTCAAGCATTTCCACTACTTT
GTTCATTGAGGGACGATCGCTTGGTTTCAACTGTATACACCAAAGTGAAACAATGATCATCTTTTTTGCTATTTTATTTTCCTCCTCTGTGACACCTTCC
ATTTCTATATCTGTCTCTTTTCCAAGTTGATTATAAATCCAAAAGGGAAAGTAAAGTTGACTTGAATGATCTGCATGGGGATTTAGGTTCTTCCTCTTAC
TTGCCATCTCTATCAAAAGCATCCCAAAGCTATAAACATCAGCCTTGTGGGATATTCCTCCAATATTTTTATAAAATAATTCTAGAGCCATATACCCAA