Detailed information on CNT30710214


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6VAG0|TBA2_GOSHI, E-value = 1e-47

BLAST vs NONCODE:
NONGMAT000220, E-value = 3e-108

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694759Glycine maxOryza sativa5030.5886.84152forward
CNT30237104Glycine maxBrassica oleracea99.0192.981.06301forward
CNT30721658Glycine maxTriticum spelta59.2143.3783.89180forward
CNT30619808Glycine maxCajanus cajan99.0150.5988.37301forward
CNT30597159Glycine maxOryza meridionalis63.8226.886.6194forward
CNT30704384Glycine maxPrunus avium29.2815.9885.3989forward
CNT30106559Glycine maxOryza longistaminata49.6767.4185.43151forward
CNT30331419Glycine maxDioscorea rotundata50.6654.882.47154forward
CNT30147962Glycine maxBrachypodium distachyon94.0884.3784.27286forward
CNT30104256Glycine maxOryza rufipogon99.0123.1584.72301forward
CNT30578324Glycine maxOryza barthii85.5326.4885.38260forward
CNT30117847Glycine maxOryza nivara92.4329.9984.34281forward
CNT3065151Glycine maxSelaginella moellendorffii15.4622.8289.3647forward

Expression of CNT30710214

Peptides detected in this lncRNA

>peptide 1 (78 aa)
VGVGRTFNVKGAPTDVIDGFIIQKDSNIGVLQERVGGDLRGGVDSETKLGFLAIINGETLQQKGTKSRTSSSTNGIEY*

Sequence

>CNT30710214
GGTTGGTGTAGGTAGGACGTTCAATGTCAAGGGAGCGCCTACAGATGTCATAGATGGCTTCATTATCCAAAAGGACAGCAACATCGGTGTGCTCCAAGAG
AGAGTGGGTGGAGACCTGAGGGGAGGGGTAGACAGTGAAACCAAGCTTGGATTTCTTGCCATAATCAACGGAGAGACGCTCCAACAGAAGGGAACCAAGT
CCAGAACCAGTTCCTCCACCAACGGCATTGAATACTAAGAACCCTTGGAGTCCAGTGCAGTTGTCAGCAAGCTTTCTGATGCGGTCCAAGCACAGATCAA
CGAT