Detailed information on CNT30710027


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39654|PSAL_CUCSA, E-value = 4e-53

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30710027

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MFELNLDFLGLPHYSPQPFLSQLTHFFTSR*

>peptide 2 (40 aa)
MRLNFSKRCSLILLYPRFQYHYRIVVLAKDSDLCKCKSDT*

>peptide 3 (34 aa)
MGLLRPPRSLLVVGSLRFCMRAGWTSTMRSKGWM*

>peptide 4 (36 aa)
KARIGERNEHYNMLRVIQYIIYIHLYCTNSPFMENE*

Sequence

>CNT30710027
AAGGCGAGAATAGGAGAGAGGAATGAACATTATAACATGTTGAGAGTCATACAATACATCATTTACATCCATCTCTATTGCACAAATAGTCCATTCATGG
AGAATGAATAAGAAAAAGTAAAGAAAGCTAGTAAGCACATTCATCATTTGATGTAGTATGGAAGGTCCAAGACGTAGAGGAGGAAGTAGGCCCAAATAAC
ACCCGAAATGCCTCCGAAGAAGAAGCCTCCGGTGAACTTGGCCCACCCATCAGCAGTTTGGAGCTGATCGGGCTCCTTCTTGCGGCCCGTCAAGGTCAGC
GACGGAGCAGTGGATGGGGCTCCTTCGCCCACCTCGATCCCTCTTAGTAGTGGGCTCACTGCGGTTCTGTATGCGGGCAGGTTGGACAAGTACCATGCGA
TCAAAGGGCTGGATGTAACTGGGGTTTCCAGGCTTCCAATGAATGGGTCACCGTTGATTGGCTGAATCACTTGATAGGTTGGCTGCCAGTAAATTTTAAA
TTTTGCAATAACCAAAACCAAGAAAAACATTAATGACTTCTTATTGAATATATTCATTTTGGGATTTATTTAATTAAACCAAACAAAGATTTTATGTACT
ATATAAAATTTAATTTAAATATTTGGGGCAGCAAAATAGAAAAAAGGTTGGGTTAGTTTGGTCACCTGAAATGTAAGACTTGGACTTTAAATGTTTAATT
CGAATTAAACAGGATTATTTTAACTCAATTTTGATCCAATCTTAGCCCACAAAAACACCAAATCTCCAACAACAAAAAAAAACTTTCACTAGACCTTACT
TAACCTAGATGTTTGAATTGAATCTGGACTTCCTTGGTTTGCCTCACTATAGTCCACAACCTTTTTTGAGCCAACTAACCCATTTTTTCACTTCTCGTTA
AACTATATTCAATTACAAGTTGGCATATTAACATAAGATTATTAACTTTTATAATAACTTAATTTAAAATTATATCTTCAATGATTTTTAATTAATCAAA
TAATGCAAAAATATTGATATTGAATAACTATTTGTTTCTGAAAATTAAACTCTTATTTTAAAAATATTTATCCTAAACAATGAGATTAAACTTTTCCAAA
AGATGTTCTTTGATACTACTCTATCCTAGATTCCAATACCATTATAGAATTGTAGTGTTAGCAAAGGACTCGGATTTATGTAAATGTAAATCGGATACAT
GATAACATATTCACAATGAAAATTAAATTGTGAAAGATGAATATATTGCCCTAATCTACATTAACATGACTAGTATATTCCAAGAAGAAAAGAAAAGGGT
CATCCATACTAGCTCAAAAAGGACATTGGTTAGAATTAGATAGATAAATAACAAGAAAAGAGAGTAA