Detailed information on CNT30710020


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39654|PSAL_CUCSA, E-value = 2e-84

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3021623Glycine maxCitrullus lanatus41.3913.9982.11190forward
CNT30172489Glycine maxTrifolium pratense50.541884.05232forward
CNT3075006Glycine maxBrassica juncea33.7734.4482.58155forward
CNT30261201Glycine maxBrassica rapa33.7717.4582.58155forward
CNT30135064Glycine maxLolium perenne39.4331.781.22181forward
CNT30578384Glycine maxOryza barthii25.2729.5985.34116forward
CNT30582394Glycine maxEchinochloa crusgalli25.9331.984.03119forward
CNT30112090Glycine maxFicus carica51.211.4883.4235forward
CNT30726870Glycine maxLupinus angustifolius94.1242.8186.34432forward

Expression of CNT30710020

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MGPPEGIRGPGPPRSLLVVGSLRFCMRAGWTSTMRSKGWM*

Sequence

>CNT30710020
AAGCTAGTAAGCACATTCATCATTTGATGTAGTATGGAAGGTCCAAGACGTAGAGGAGGAAGTAGGCCCAAATAACACCCGAAATGCCTCCGAAGAAGAA
GCCTCCGGTGAACTTGGCCCACCCATCAGCAGTTTGGAGCTGATCGGGCTCCTTCTTGCGGCCCGTCAAGGTCAGCGACGGAGCAGTGGATGGGGCTCCT
TCGTTGAAGGATGAAATCCCATAGATTGTGAGGCAAAGGCTGAGGATCACCACAAGCCCGGCCTTCACGAATGGGCCCACCAGAAGGTATCCGTGGGCCA
GGCCCACCTCGATCCCTCTTAGTAGTGGGCTCACTGCGGTTCTGTATGCGGGCAGGTTGGACAAGTACCATGCGATCAAAGGGCTGGATGTAACTGGGGT
TTCCAGGCTTCCAATGAATGGGTCACCGTTGATTGGCTGAATCACTTGATAGGTTGGCT