Detailed information on CNT30710018


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30710018

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MERLSPLTSIHCNNLFSVFIPYYKKRVQPYTSPSRFLRFY*

>peptide 2 (44 aa)
QTCSSNRKCHYCLCNPELWSPNPSLYIHIFSATYSFAAIFISQL*

>peptide 3 (47 aa)
MVSKSIPIHTHFLCNLLFRSHFYFTTLNIHNNSNQYGETFSSNLNPL*

>peptide 4 (48 aa)
HKHAAATESVTTVYATLNYGLQIHPYTYTFSLQPTLSQPFLFHNSEYP*

>peptide 5 (77 aa)
MTVVAVNCNDKQVLEVVAEEVTLYKVVEMGVAVVVNKLVGEESELEEVVAVINRDKLVVVVVVNVVVAVANEVEVAVE

Sequence

>CNT30710018
CACAAACATGCAGCAGCAACAGAAAGTGTCACTACTGTCTATGCAACCCTGAATTATGGTCTCCAAATCCATCCCTATACATACACATTTTCTCTGCAAC
CTACTCTTTCGCAGCCATTTTTATTTCACAACTCTGAATATCCATAACAATTCAAATCAATATGGAGAGACTTTCTCCTCTAACCTCAATCCACTGTAAC
AACCTCTTCTCAGTTTTCATCCCATATTACAAAAAACGTGTGCAGCCTTACACAAGCCCTTCTCGATTTCTCAGGTTTTATTAATTTTGCGACGAGTGTC
GCGTACTTGACCTGGCTGGCACAGGAAGAAGAGGGCACGGAAGAAATGGCCACCAATAATAACAAAAGTATGAACTGATCTTGAATGGGTGTTTTTGGTT
TTTTTTCGTTGCTATGGTAGAGGCGAAGGGTTAGAGGAGAAAAGTTCTCAAAAGAATCAATAAAAGGGTGGTGGAGGAGGAGATGCATACGAGACTCCGA
TGACGGGTGGCAAAGGCCCTTCATATACAGGTGCAGGTGGTGGAGATGACGGTGGTGGCGGTGAATTGTAATGATAAACAGGTGTTGGAGGTGGTGGCGG
AGGAGGTGACTCTATACAAGGTGGTGGAGATGGGGGTGGCGGTGGTGGTGAATAAACTGGTGGGGGAGGAGAGTGAACTGGAGGAGGTGGTGGCGGTGAT
AAATAGGGATAAACTGGTGGTGGTGGTGGTGGTGAATGTGGTGGTGGCGGTGGCGAATGAGGTGGAGGTGGCGGTGGAGAG