Detailed information on CNT30709956


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONBNAT004661, E-value = 1e-114

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676994Glycine maxSetaria viridis59.0253.1187.92265forward
CNT30381505Glycine maxManihot esculenta39.8761.5191.62179forward
CNT30403504Glycine maxBeta vulgaris38.5378.2894.8173reverse complement
CNT30525072Glycine maxPhaseolus vulgaris29.6231.1593.98133reverse complement
CNT30196411Glycine maxPisum sativum67.0423.7992.03301forward
CNT30227123Glycine maxHordeum vulgare33.4139.6896150forward
CNT3087623Glycine maxVigna radiata41.8790.3895.21188reverse complement
CNT30554009Glycine maxOryza glaberrima59.0248.6289.81265forward
CNT30441550Glycine maxAegilops tauschii33.4121.995.33150forward
CNT3062651Glycine maxArabidopsis lyrata50.3327.1695.13226reverse complement
CNT30612440Glycine maxArabis alpina49.4498.6791.89222forward
CNT30357533Glycine maxLactuca sativa67.0429.5793.69301forward
CNT30370808Glycine maxOryza glumipatula22.9447.4795.15103forward
CNT3056240Glycine maxAmborella trichopoda53.984.6293.8242forward
CNT30576679Glycine maxOryza barthii56.5748.3890.94254forward

Expression of CNT30709956

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MGDKLHRQEGNSPDHQLRPLNDRSVIKEVGVQRQPGGFPRSS

Sequence

>CNT30709956
ATGAAACTGTAAGCTCCCATGCAGTGGGAGGAGGCTCGAGACTCTGATCGCATGCCTGTTGAAGAATGAGTCGGTGACTCATAGGCAGTGGCTTGGTTAA
GGGAAACCACCGGAGCCGTAGCGAAAGCGAGTCTTCATAGGGCAATTGTCACTGCTTATGGACCCAAACCTGGGTGATCTGTCCATGACCAAGATGAAGC
TTGGGTGAAACTAAGAGGAGGTCCGAACTGACTAATGTTGAAGAATCAGTGGATAAGTTGTGGTTAGGGGTGAAATGCCACTCGAACCCAGAGCTAGCTG
GGTCAAGGTCGGCCAGTGAGACGATGGGGGATAAGCTTCATCGTCAAGAGGGAAACAGCCCAGATCACCAGCTAAGGCCCCTAAATGACCGCTCAGTGAT
AAAGGAGGTAGGGGTGCAGAGACAACCAGGAGGTTTTCCTAGAAGCAGC