Detailed information on CNT30709891


BLAST search results

BLAST vs Swiss-Prot:
sp|Q42679|DCAM_CATRO, E-value = 2e-71

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30512045Glycine maxJuglans regia62.1251.4383.27269forward
CNT30146877Glycine maxMedicago truncatula54.7353.9983.12237forward
CNT3026411Glycine maxPopulus trichocarpa35.114.5680.26152forward
CNT30112510Glycine maxFicus carica65.1356.2979.08282forward

Expression of CNT30709891

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MLGGLFLQGQQTHHVQKMISQVFFHSLRNQ*

>peptide 2 (41 aa)
MKLPRVYLTDFTAMSRASANLRMTGMDRSNLVVPQVLMIIL*

Sequence

>CNT30709891
CTCCTCTGAAAAACTGCGGTGAGGAAAAGACTGTGCCCCAGGAAAAATGAAACTTCCACGAGTGTACCTCACAGATTTCACAGCAATGTCAAGAGCATCA
GCCAACTTGAGGATGACAGGGATGGACAGAAGCAATTTGGTAGTCCCACAAGTTTTGATGATAATTTTATAAGGATAGATGAACAGGCTTGACTCTGACA
GAACATAAGAGTCAACATAATCGTTTGAAAGTGATGCAACAATACTGCACTCTGCTGGTTTAAGAATCTCGTCCAATTGGTCTTTGGACAATGCTCGGAG
GCCTATTCCTTCAGGGTCAGCAAACACACCATGTTCAAAAAATGATATCTCAAGTCTTTTTTCATAGCCTTCGAAACCAATAGCTGAGCCAGCCATCTTG
ACTCAAAAAGAAACAAAGATGGCTTGCGGATGC