Detailed information on CNT30709417


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30631820Glycine maxVigna unguiculata18.542.3483.69141reverse complement
CNT3087374Glycine maxVigna radiata34.3830.979.01262forward

Expression of CNT30709417

Peptides detected in this lncRNA

>peptide 1 (61 aa)
METSSGRESKHKTLSCNRSPASSTLRLSKQKISLKEPSHTTSFSILGASCRISYGNSSDPI*

Sequence

>CNT30709417
TACCTTTTTCCTAAATGCCTCCCGCATGGTAGAGTTCAGGTCATTTTCCAATTTGATAGCATCTGATGACTCCTCAAGTTGAACTTGAACCAACTTGTCT
GCTTTTAGGGTACCTGGACATAATGTTTCCATCCACTCGCACTTGATTACTGACAATTCCTCCAATGATGGGAAACTTAATAAACTTCCTCTGTAGAACC
TTCTCAGCTTTCCTATTCTTTCAAGTTTCAAACAATTGAGCTGCGGAAATATTATTCCCTCCTCATGTGATTCATCCCCCTCCTTAGAGACTACTACCTC
TTCAATTGAATCACACCATTTTATCTCCATTCTTTTGAGTTGACCCAAACTTCTTGCTGTGGAGGATGTGAACAAATATAGCAGGCAATGGCATCTTTCT
ACTTCCAAATATGTCAGATTGGAGAAAGACACTGTAGATGGTACCAAGTCTTTTAAACTAGAACAACCTATTACTTCCAAGGTTTCTAGATTTCCCAGTA
AGGGCTGAATCCAAGAGTTCTCTAACCCAATGGAAACAAGCTCTGGAAGGGAGTCCAAGCATAAGACTTTGAGCTGTAATAGGAGTCCAGCCTCATCCAC
ATTAAGACTATCAAAGCAGAAAATCTCCTTGAAGGAACCATCACACACCACAAGCTTCTCTATATTGGGCGCCAGTTGTAGAATTTCATATGGAAATTCA
TCGGACCCTATATGAAAGCCCACAGTAAGAACTTGTAGCTTGTGCAAGAAGTTTCTCTGAAA