Detailed information on CNT30709412


BLAST search results

BLAST vs Swiss-Prot:
sp|P14009|14KD_DAUCA, E-value = 2e-31

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30709412

Peptides detected in this lncRNA

>peptide 1 (82 aa)
MCPWGMKLWVAKEEKVEDNQPWVWVVWVWVWVVWALEWVVLVLELVAWALEWEVLVLELVVWVVWASEMEMELEWVVGNWHE*

>peptide 2 (89 aa)
MSAQTPSFNVSLGHEALGGEGGEGGGQPALGVGGVGVGVGGVGFGVGGVGFGVGGVGFGVGGVGFGVGGVGGVGFGDGDGVGVGGGQLA*

Sequence

>CNT30709412
CATATCTAAACATTTCTCTGACGGCAGATCGAGACGATGAGAGATAACTCGACCTAATTTGATTAATATCTTAGGAGGGACATTGGAAACCAGGAGGAAC
AGTTTTTTGACAAGCACTAAGGATCACGCTGAGCGTGACAGGTACGTTCAAGTTTATTCCAAGCACATTGGCCTTAATTGCGGTGCATAGGCAAAGTGCA
GCTTCCAAATCTGCCAAACCCTTAACCAATGCACAGCATTCGCTCGAAGGAGGAGTTCCAACAGTAACGTTAACAAGTCCTAAGATGTCAGCACAAACAC
CTAGCTTTAATGTGTCCTTGGGGCATGAAGCTTTGGGTGGCGAAGGAGGAGAAGGTGGAGGACAACCAGCCTTGGGTGTGGGTGGTGTGGGTGTGGGTGT
GGGTGGTGTGGGCTTTGGAGTGGGTGGTGTTGGTTTTGGAGTTGGTGGCGTGGGCTTTGGAGTGGGAGGTGTTGGTTTTGGAGTTGGTGGTGTGGGTGGT
GTGGGCTTCGGAGATGGAGATGGAGTTGGAGTGGGTGGTGGGCAATTGGCATGAGTGAATGTTGAGTAAAAGAGGAGAGAAAGCACCAAAATGGTGGCAA
GGAGTTTGTTGGAAGCCATAGAAAATAAGAAAATTAAGAAGTGGCAATGTGTGTAGTTTGATTGATGTTGAATGGGAAGGTGAAGAAGGGACGTAGACCT
ATTTAAAGACAATATGTGACGGGTGTGTTATTGAAAT