Detailed information on CNT30709218


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30709218

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MEEVVVVVVGTLYLTFLVNNLLVEGNVSIRGGGDACGCGGILQSHPPHKQSSR*

>peptide 2 (49 aa)
MHVVVAGSSNHILLINNLLVEDTVSIRVVVVAHHWSWCGILHDRFPLNF*

Sequence

>CNT30709218
TCTTGATTGATTGATTCTTGGTTCCTCACAACTGGTGGTAAAGTTTGAAAAAACAACAAATCATCGCATGCGATAGCATATGCATGGTAACTGGCTTTAT
TGAAATGATATATGTATGATTATAACATAATGGCTAACTAAGCAGGAATTTATTTAATATAAGCACACTGGTGATTAATTTTGATATACTAGGTGGCCTG
CTTAGCAAACCATTCAAGGCCACACTGTCCTGTTCTCTTCGTAGACAACTTCAGCGACGCGCCTCTCAGGAACTTGCTCATACTCTACCACCTTAACACT
CTCACGAGTCTCTGGGTGGTGGTGCCTATGGAAGAGGTGGTGGTGGTGGTGGTGGGAACCCTCTATCTCACTTTCCTCGTAAACAACCTTCTTGTTGAGG
GAAACGTGAGCATTAGGGGTGGTGGTGATGCATGTGGTTGTGGCGGGATCCTCCAATCACATCCTCCTCATAAACAATCTTCTCGTTGAGGACACGGTGA
GCATTAGGGTGGTGGTAGTTGCCCATCATTGGTCGTGGTGTGGAATACTCCATGATAGGTTCCCTCTCAACTTCTGAAACGCGGGTGTAGTAGTCCATGT
TGATCTTAGTTTGTGTTGGGTATACACTCACAAGTACTTTGGTGATCTTAATTTGCTCTT