Detailed information on CNT30709081


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6VAF9|TBA4_GOSHI, E-value = 3e-156

BLAST vs NONCODE:
NONGMAT000220, E-value = 1e-69

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678108Glycine maxSetaria viridis82.8568.6182.83623forward
CNT30640127Glycine maxNymphaea colorata42.1539.7286.75317forward
CNT30547493Glycine maxIpomoea triloba99.4766.9182.75748forward
CNT30501067Glycine maxCoffea canephora87.2390.7383.69656forward
CNT3071007Glycine maxQuercus suber50.5374.3683.16380forward
CNT30507454Glycine maxNicotiana attenuata44.9552.0883.43338forward
CNT30177336Glycine maxSecale cereale99.3465.1884.07747forward
CNT30294619Glycine maxTriticum aestivum78.3269.9584.04589forward
CNT30144688Glycine maxMedicago truncatula18.6239.4490.71140forward
CNT3079816Glycine maxBrassica juncea18.0949.4590.44136forward
CNT30611949Glycine maxArabis alpina15.2933.2485.22115forward
CNT30219368Glycine maxKalanchoe fedtschenkoi30.5939.3885.22230forward
CNT30655223Glycine maxRosa chinensis22.7467.3285.96171forward
CNT30210906Glycine maxHelianthus annuus25.874.3382.99194forward
CNT30360524Glycine maxLactuca sativa25.830.2782.47194forward
CNT30570163Glycine maxVitis vinifera47.7443.3686.63359forward
CNT3052700Glycine maxAmborella trichopoda39.193.0480.61294forward
CNT30575645Glycine maxOryza barthii83.6474.1782.03629forward
CNT30117821Glycine maxOryza nivara68.4846.4481.36515forward
CNT30558847Glycine maxPanicum hallii40.9641.7383.12308forward
CNT3040082Glycine maxMarchantia polymorpha37.7767.6281.34284forward

Expression of CNT30709081

Peptides detected in this lncRNA

>peptide 1 (93 aa)
VDAREDLNNTGGIGDHAHGPLNLGKITTWNNSRRLVIDSTLEPGGAPVNKLNSALGLDNSNSCINIFRHYVTSVHETARHVFAMAGITLGHHR*

>peptide 2 (60 aa)
MAQGWCRLASQCPVNACRCHKWLHCRAGQPHQCAQEENEWRGHCCKAQQQRSKLGVKDRQ*

>peptide 3 (36 aa)
RCERRPQQHWWNWRSCTRPSEPWQDHHLEQQSEAGN*

>peptide 4 (36 aa)
MRQHAMYLPWRGSHLAIIDDGSNALLVISPTDSCSW*

Sequence

>CNT30709081
GTCGATGCGAGAGAAGACCTCAACAACACTGGTGGAATTGGAGATCATGCACACGGCCCTCTGAACCTTGGCAAGATCACCACCTGGAACAACAGTCGGA
GGCTGGTAATTGATTCCACACTTGAACCCGGTGGGGCACCAGTCAACAAATTGAATAGTGCGCTTGGTCTTGATAATTCCAACAGCTGCATTAACATCTT
TAGGCACTACGTCACCTCTGTACATGAGACAGCACGCCATGTATTTGCCATGGCGGGGATCACACTTGGCCATCATAGATGATGGCTCGAATGCACTGTT
GGTGATTTCACCAACTGATAGCTGCTCATGGTGAGCCTTCTCGGCTGAAATTACAGGAGCATAAGATGAAAGCATAAAATGAATCCTGGGGTATGGCACA
AGGTTGGTGTAGGTTGGCCTCTCAATGTCCAGTGAACGCCTGCAGATGTCATAAATGGCTTCATTGTCGAGCAGGACAGCCACATCAGTGTGCTCAAGAA
GAGAATGAGTGGAGAGGACACTGTTGTAAGGCTCAACAACAGAGGTCGAAACTTGGGGTGAAGGATAGACAGTGAAACCAAGCTTGGACTTCTTGCCATA
GTCCACTGAAAGGCGTTCCAGCAAAAGGGAACCAAGTCCAGAGCCAGTTCCCCCACCCACAGCATTGAAAACCAGAAAACCTTGGAGACCTGTGCAGTTG
TCAGCAAGCTTTCTGATGCGGTCCAAGCAAAGCTCAACAATCTCCTTTCCAA